Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen

Images

 
There are currently no images for Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen (NBP2-76500PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ubiquitin-activating Enzyme/UBE1.

Source: E. coli

Amino Acid Sequence: LYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76500.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen

  • A1S9T and BN75 temperature sensitivity complementing
  • A1S9T
  • A1ST
  • AMCX1
  • GXP1
  • MGC4781
  • POC20 centriolar protein homolog
  • POC20
  • Protein A1S9
  • SMAX2
  • UBA1
  • UBA1, ubiquitin-activating enzyme E1 homolog A
  • UBA1A
  • UBE1
  • UBE1A1S9
  • UBE1X
  • ubiquitin-activating enzyme E1 (A1S9T and BN75 temperature sensitivitycomplementing)
  • Ubiquitin-activating enzyme E1
  • Ubiquitinactivating Enzyme
  • Ubiquitin-activating Enzyme
  • ubiquitin-like modifier activating enzyme 1
  • ubiquitin-like modifier-activating enzyme 1

Background

E1 Ubiquitin Activating Enzyme is encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03688
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87911
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00007318-B01P
Species: Hu
Applications: ICC/IF, WB
NBP3-46656
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NB100-55328
Species: Hu
Applications: IP, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
UL-812
Species: Hu, Mu, Rt
Applications: EnzAct
NBP2-48628
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-46538
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DTM100
Species: Hu
Applications: ELISA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
UL-553
Species: Hu
Applications: EnzAct
NBP1-82245
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-76500PEP
Species: Hu
Applications: AC

Publications for Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen (NBP2-76500PEP) (0)

There are no publications for Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen (NBP2-76500PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen (NBP2-76500PEP) (0)

There are no reviews for Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen (NBP2-76500PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen (NBP2-76500PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ubiquitin-activating Enzyme/UBE1 Products

Research Areas for Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen (NBP2-76500PEP)

Find related products by research area.

Blogs on Ubiquitin-activating Enzyme/UBE1

There are no specific blogs for Ubiquitin-activating Enzyme/UBE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ubiquitin-activating Enzyme/UBE1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UBA1