UBE2N/Ubc13 Recombinant Protein Antigen

Images

 
There are currently no images for UBE2N/Ubc13 Recombinant Protein Antigen (NBP2-48823PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UBE2N/Ubc13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBE2N/Ubc13.

Source: E. coli

Amino Acid Sequence: IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBE2N
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48823.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UBE2N/Ubc13 Recombinant Protein Antigen

  • bendless-like ubiquitin conjugating enzyme
  • Bendless-like ubiquitin-conjugating enzyme
  • BLU
  • EC 6.3.2.19
  • MGC131857
  • MGC8489
  • UBC13
  • UbcH13
  • UbcH-ben
  • UBE2N
  • Ubiquitin carrier protein N
  • ubiquitin-conjugating enzyme E2 N
  • ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)
  • ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
  • Ubiquitin-protein ligase N
  • yeast UBC13 homolog

Background

UBC13 is a member of the E2 ubiquitin-conjugating enzyme family also known as Ubiquitin-conjugating enzyme E2 N, Ubiquitin-protein ligase N, Ubiquitin carrier protein N and Bendless-like ubiquitin-conjugating enzyme. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. UBC13 forms a heterodimer with UBE2V2 which then catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. UBC13 also mediates transcriptional activation of target genes and plays a role in the control of progress through the cell cycle and differentiation, as well as error-free DNA repair. UBC13 also contributes to the survival of cells after DNA damage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56360
Species: Hu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-57183
Species: Hu
Applications: ICC/IF, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF7114
Species: Hu
Applications: WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, ISH, KD, KO, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NB100-56363
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
H00051364-M24
Species: Hu
Applications: ELISA, S-ELISA, WB

Publications for UBE2N/Ubc13 Recombinant Protein Antigen (NBP2-48823PEP) (0)

There are no publications for UBE2N/Ubc13 Recombinant Protein Antigen (NBP2-48823PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2N/Ubc13 Recombinant Protein Antigen (NBP2-48823PEP) (0)

There are no reviews for UBE2N/Ubc13 Recombinant Protein Antigen (NBP2-48823PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UBE2N/Ubc13 Recombinant Protein Antigen (NBP2-48823PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBE2N/Ubc13 Products

Research Areas for UBE2N/Ubc13 Recombinant Protein Antigen (NBP2-48823PEP)

Find related products by research area.

Blogs on UBE2N/Ubc13

There are no specific blogs for UBE2N/Ubc13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UBE2N/Ubc13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2N