UBE2N/Ubc13 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

UBE2N/Ubc13 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBE2N/Ubc13.
  
  

  Source: E. coli

  Amino Acid Sequence: IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: UBE2N
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48823.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UBE2N/Ubc13 Recombinant Protein Antigen

• bendless-like ubiquitin conjugating enzyme
• Bendless-like ubiquitin-conjugating enzyme
• BLU
• EC 6.3.2.19
• MGC131857
• MGC8489
• UBC13
• UbcH13
• UbcH-ben
• UBE2N
• Ubiquitin carrier protein N
• ubiquitin-conjugating enzyme E2 N
• ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)
• ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
• Ubiquitin-protein ligase N
• yeast UBC13 homolog

Background

UBC13 is a member of the E2 ubiquitin-conjugating enzyme family also known as Ubiquitin-conjugating enzyme E2 N, Ubiquitin-protein ligase N, Ubiquitin carrier protein N and Bendless-like ubiquitin-conjugating enzyme. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. UBC13 forms a heterodimer with UBE2V2 which then catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. UBC13 also mediates transcriptional activation of target genes and plays a role in the control of progress through the cell cycle and differentiation, as well as error-free DNA repair. UBC13 also contributes to the survival of cells after DNA damage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: UBE2N