UBE2E3 Antibody (3E9) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: UBE2E3 Antibody (3E9) [H00010477-M05] - Analysis of monoclonal antibody to UBE2E3 on HeLa cell. Antibody concentration 10 ug/ml

ELISA: UBE2E3 Antibody (3E9) [H00010477-M05] - Detection limit for recombinant GST tagged UBE2E3 is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3E9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

UBE2E3 Antibody (3E9) - Azide and BSA Free Summary

• Immunogen: UBE2E3 (NP_006348, 65 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDN
• Specificity: UBE2E3 - ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast) (3E9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: UBE2E3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2E3 Antibody (3E9) - Azide and BSA Free

• E2-23K
• EC 6.3.2.19
• UBCE4
• UbcH9
• UBCH9ubiquitin-conjugating enzyme E2E 3 (homologous to yeast UBC4/5)
• UbcM2
• UBE2E3
• Ubiquitin carrier protein E3
• ubiquitin-conjugating enzyme E2 E3
• Ubiquitin-conjugating enzyme E2-23 kDa
• ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast)
• Ubiquitin-protein ligase E3

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse and rat counterparts, which indicates that this enzyme is highly conserved in eukaryotes. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBE2E3
• Entrez:
  • 10477(Human)
• Uniprot:
  • NP_006348(Human)