Recombinant Human UBA52 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UBA52 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 29-128 of Human UBA52 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
UBA52

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UBA52 Protein

  • CEP52ubiquitin carboxyl extension protein 52
  • HUBCEP52
  • MGC126879
  • MGC126881
  • MGC57125
  • RPL40
  • UBCEP2
  • ubiquitin A-52 residue ribosomal protein fusion product 160S ribosomal protein L40
  • ubiquitin-52 amino acid fusion protein
  • ubiquitin-60S ribosomal protein L40
  • ubiquitin-CEP52

Background

UBA52 - ubiquitin A-52 residue ribosomal protein fusion product 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-130
Species: Hu, Mu, Rt, Bv, Ce, Ch, Dr, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30404
Species: Hu
Applications: IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00028299-P01
Species: Hu
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57629
Species: Hu
Applications: ICC/IF
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-57476
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-81212
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81330
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13255
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30682
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13252
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007311-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for UBA52 Partial Recombinant Protein (H00007311-Q01) (0)

There are no publications for UBA52 Partial Recombinant Protein (H00007311-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBA52 Partial Recombinant Protein (H00007311-Q01) (0)

There are no reviews for UBA52 Partial Recombinant Protein (H00007311-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBA52 Partial Recombinant Protein (H00007311-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBA52 Products

Bioinformatics Tool for UBA52 Partial Recombinant Protein (H00007311-Q01)

Discover related pathways, diseases and genes to UBA52 Partial Recombinant Protein (H00007311-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBA52 Partial Recombinant Protein (H00007311-Q01)

Discover more about diseases related to UBA52 Partial Recombinant Protein (H00007311-Q01).
 

Pathways for UBA52 Partial Recombinant Protein (H00007311-Q01)

View related products by pathway.

PTMs for UBA52 Partial Recombinant Protein (H00007311-Q01)

Learn more about PTMs related to UBA52 Partial Recombinant Protein (H00007311-Q01).

Blogs on UBA52

There are no specific blogs for UBA52, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Ubiquitin
U-100H-10M

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UBA52 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UBA52