Tyrosylprotein Sulfotransferase 2/TPST2 Recombinant Protein Antigen

Images

 
There are currently no images for Tyrosylprotein Sulfotransferase 2/TPST2 Protein (NBP1-86023PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tyrosylprotein Sulfotransferase 2/TPST2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TPST2.

Source: E. coli

Amino Acid Sequence: IAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TPST2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86023.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tyrosylprotein Sulfotransferase 2/TPST2 Recombinant Protein Antigen

  • EC 2.8.2.20
  • TPST2
  • TPST-2
  • tyrosylprotein phosphotransferase 2
  • Tyrosylprotein Sulfotransferase 2
  • tyrosylprotein sulfotransferase 2protein-tyrosine sulfotransferase 2
  • tyrosylprotein sulfotransferase-2

Background

The protein encoded by the TPST2 gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 both encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5468-ST
Species: Hu
Applications: BA
MAB6534
Species: Hu
Applications: ELISA, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
MAB1429
Species: Hu
Applications: CyTOF-ready, Flow, Neut
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
AF3848
Species: Hu
Applications: IHC, IP, WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO
AF5110
Species: Mu
Applications: IHC, WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-20223
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
H00009242-M01
Species: Hu
Applications: ELISA, WB

Publications for Tyrosylprotein Sulfotransferase 2/TPST2 Protein (NBP1-86023PEP) (0)

There are no publications for Tyrosylprotein Sulfotransferase 2/TPST2 Protein (NBP1-86023PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tyrosylprotein Sulfotransferase 2/TPST2 Protein (NBP1-86023PEP) (0)

There are no reviews for Tyrosylprotein Sulfotransferase 2/TPST2 Protein (NBP1-86023PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tyrosylprotein Sulfotransferase 2/TPST2 Protein (NBP1-86023PEP). (Showing 1 - 1 of 1 FAQ).

  1. What is the lower limit of detection for TPST2 in Western blot?
    • We generally do not test the limits of detection for our antibodies as this time. I apologize for the inconvenience.

Additional Tyrosylprotein Sulfotransferase 2/TPST2 Products

Research Areas for Tyrosylprotein Sulfotransferase 2/TPST2 Protein (NBP1-86023PEP)

Find related products by research area.

Blogs on Tyrosylprotein Sulfotransferase 2/TPST2

There are no specific blogs for Tyrosylprotein Sulfotransferase 2/TPST2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tyrosylprotein Sulfotransferase 2/TPST2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TPST2