TWF2 Antibody - BSA Free

Western Blot: TWF2 Antibody [NBP2-88523] - Host: Rabbit. Target Name: TWF2. Sample Type: PANC1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TWF2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TWF2 Antibody - BSA Free (NBP2-88523) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TWF2. Peptide sequence: IGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TWF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TWF2 Antibody - BSA Free

• A6-related protein
• A6RPFLJ56277
• hA6RP
• protein tyrosine kinase 9-like (A6-related protein)
• Protein tyrosine kinase 9-like
• PTK9L protein tyrosine kinase 9-like (A6-related protein)
• PTK9LA6r
• twinfilin, actin-binding protein, homolog 2 (Drosophila)
• Twinfilin-1-like protein
• twinfilin-2

Background

TWF2, also known as Twinfilin-2, is a 349 amino acid protein that is 40 kDa, ubiquitously expressed at protein level, involved in motile and morphological processes, inhibits actin polymerization by sequestering G-actin, and regulates motility by capping the barbed ends. It seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles and participates in regulating the mature length of the middle and short rows of stereocilia. Current research is being performed on several diseases and disorders including monkeypox, cowpox, smallpox, vaccinia, meningioma, leukemia, and neuronitis. The TWF2 protein has shown an interaction with ARHGDIA, ACTR3B, CHGB, CAPZA1, and CAPZA2 in positive regulation of lamellipodium assembly, positive regulation of neuron projection development, cell projection organization, negative regulation of actin filament polymerization, and regulation of microvillus length pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TWF2