TULP4 Antibody

Images

 
Western Blot: TULP4 Antibody [NBP2-88522] - WB Suggested Anti-TULP4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TULP4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human TULP4. Peptide sequence: MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGN The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Rabbit (100%), Guinea Pig (100%), Zebrafish (100%), Equine (100%), Canine (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TULP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TULP4 Antibody

  • KIAA1397tubby super-family protein
  • tubby like protein 4
  • Tubby superfamily protein
  • Tubby-like protein 4
  • TUBL4
  • TUSPtubby-related protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20758
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22896
Species: Hu
NBP2-67906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NBP1-91830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01671
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB974
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-31491
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92581
Species: Hu
Applications: IHC, IHC-P
NBP2-88522
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for TULP4 Antibody (NBP2-88522) (0)

There are no publications for TULP4 Antibody (NBP2-88522).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TULP4 Antibody (NBP2-88522) (0)

There are no reviews for TULP4 Antibody (NBP2-88522). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TULP4 Antibody (NBP2-88522) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TULP4 Products

Bioinformatics Tool for TULP4 Antibody (NBP2-88522)

Discover related pathways, diseases and genes to TULP4 Antibody (NBP2-88522). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TULP4 Antibody (NBP2-88522)

Discover more about diseases related to TULP4 Antibody (NBP2-88522).
 

Pathways for TULP4 Antibody (NBP2-88522)

View related products by pathway.

Blogs on TULP4.

Can Tubby Make You Tubby?
The TUB gene, which encodes for the protein Tubby, is evolutionarily conserved in human, chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito, C. elegans, and rice. The gene derives its name from its role in metabolism; mice with a m...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TULP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TULP4