TUFM Antibody

Images

 
Western Blot: TUFM Antibody [NBP1-84890] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: TUFM Antibody [NBP1-84890] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: TUFM Antibody [NBP1-84890] - Staining of human small intestine shows strong cytoplasmic positivity in a granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TUFM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUFM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TUFM Protein (NBP1-84890PEP)
Publications
Read Publication using NBP1-84890.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%). Reactivity reported in scientific literature (PMID: 22749352)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TUFM Antibody

  • EFTu
  • EF-Tu
  • EFTUCOXPD4
  • EF-TuMT
  • elongation factor Tu, mitochondrial
  • P43
  • Tu translation elongation factor, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00009669-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00028299-P01
Species: Hu
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56350
Species: Hu, Mu, Rt
Applications: WB

Publications for TUFM Antibody (NBP1-84890)(1)

Reviews for TUFM Antibody (NBP1-84890) (0)

There are no reviews for TUFM Antibody (NBP1-84890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TUFM Antibody (NBP1-84890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TUFM Products

Bioinformatics Tool for TUFM Antibody (NBP1-84890)

Discover related pathways, diseases and genes to TUFM Antibody (NBP1-84890). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TUFM Antibody (NBP1-84890)

Discover more about diseases related to TUFM Antibody (NBP1-84890).
 

Pathways for TUFM Antibody (NBP1-84890)

View related products by pathway.

PTMs for TUFM Antibody (NBP1-84890)

Learn more about PTMs related to TUFM Antibody (NBP1-84890).

Blogs on TUFM

There are no specific blogs for TUFM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TUFM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TUFM