Recombinant Human TTC8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TTC8 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 416 - 514 of Human TTC8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TTC8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TTC8 Protein

  • Bardet-Biedl syndrome 8 protein
  • BBS8Bardet-Biedl syndrome type 8
  • RP51
  • tetratricopeptide repeat domain 8
  • tetratricopeptide repeat protein 8
  • TPR repeat protein 8

Background

TTC8 - tetratricopeptide repeat domain 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88690
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-34106
Species: Hu
Applications: IHC, IHC-P
NBP2-46722
Species: Hu
Applications: IHC, IHC-P
NBP1-88689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
H00166379-B01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-87196
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32740
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15747
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83942
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52654
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-80848
Species: Hu
Applications: IHC, IHC-P
20760002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-60661
Species: Hu
Applications: WB, IP
H00123016-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TTC8 Partial Recombinant Protein (H00123016-Q01) (0)

There are no publications for TTC8 Partial Recombinant Protein (H00123016-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC8 Partial Recombinant Protein (H00123016-Q01) (0)

There are no reviews for TTC8 Partial Recombinant Protein (H00123016-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC8 Partial Recombinant Protein (H00123016-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TTC8 Products

Bioinformatics Tool for TTC8 Partial Recombinant Protein (H00123016-Q01)

Discover related pathways, diseases and genes to TTC8 Partial Recombinant Protein (H00123016-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC8 Partial Recombinant Protein (H00123016-Q01)

Discover more about diseases related to TTC8 Partial Recombinant Protein (H00123016-Q01).
 

Pathways for TTC8 Partial Recombinant Protein (H00123016-Q01)

View related products by pathway.

Research Areas for TTC8 Partial Recombinant Protein (H00123016-Q01)

Find related products by research area.

Blogs on TTC8

There are no specific blogs for TTC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TTC8 Antibody
NBP1-88688
PCM1 Antibody
NBP1-87196

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TTC8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC8