TSPAN15 Antibody


Western Blot: TSPAN15 Antibody [NBP1-69340] - This Anti-TSPAN15 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TSPAN15 Antibody Summary

Synthetic peptides corresponding to TSPAN15(tetraspanin 15) The peptide sequence was selected from the C terminal of TSPAN15. Peptide sequence LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TSPAN15 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TSPAN15 Antibody

  • NET7
  • NET-7
  • Tetraspan NET-7
  • tetraspanin 15,2700063A19Rik
  • TM4SF15
  • Transmembrane 4 superfamily member 15NET7tetraspanin-15
  • transmembrane 4 superfamily member tetraspan NET-7
  • TSPAN15
  • tspan-15


TSPAN15 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Bv
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB

Publications for TSPAN15 Antibody (NBP1-69340) (0)

There are no publications for TSPAN15 Antibody (NBP1-69340).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSPAN15 Antibody (NBP1-69340) (0)

There are no reviews for TSPAN15 Antibody (NBP1-69340). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSPAN15 Antibody (NBP1-69340) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TSPAN15 Products

Bioinformatics Tool for TSPAN15 Antibody (NBP1-69340)

Discover related pathways, diseases and genes to TSPAN15 Antibody (NBP1-69340). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPAN15 Antibody (NBP1-69340)

Discover more about diseases related to TSPAN15 Antibody (NBP1-69340).

Pathways for TSPAN15 Antibody (NBP1-69340)

View related products by pathway.

PTMs for TSPAN15 Antibody (NBP1-69340)

Learn more about PTMs related to TSPAN15 Antibody (NBP1-69340).

Blogs on TSPAN15

There are no specific blogs for TSPAN15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TSPAN15 Antibody and receive a gift card or discount.


Gene Symbol TSPAN15