TSNAXIP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TSNAXIP1 Antibody [NBP2-58035] - Staining of human cell line SiHa shows localization to nucleus & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSNAXIP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LAEGKNSDQLVDVLLEEIGSGLLREKDFFPGLGYGEAIPAFLRFDGLVENKKPSKKDVVNLLKDAWKERLAEEQKETFPDFFFNFLEHR
Specificity
Specificity of human TSNAXIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSNAXIP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TSNAXIP1 Recombinant Protein Antigen (NBP2-58035PEP)

Reactivity Notes

Mouse 89%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TSNAXIP1 Antibody

  • MGC111443
  • translin-associated factor X interacting protein 1
  • translin-associated factor X-interacting protein 1
  • TXI1Trax-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80665
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76581
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91953
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74351
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87396
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP

Publications for TSNAXIP1 Antibody (NBP2-58035) (0)

There are no publications for TSNAXIP1 Antibody (NBP2-58035).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSNAXIP1 Antibody (NBP2-58035) (0)

There are no reviews for TSNAXIP1 Antibody (NBP2-58035). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TSNAXIP1 Antibody (NBP2-58035) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TSNAXIP1 Products

Bioinformatics Tool for TSNAXIP1 Antibody (NBP2-58035)

Discover related pathways, diseases and genes to TSNAXIP1 Antibody (NBP2-58035). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSNAXIP1 Antibody (NBP2-58035)

Discover more about diseases related to TSNAXIP1 Antibody (NBP2-58035).
 

Pathways for TSNAXIP1 Antibody (NBP2-58035)

View related products by pathway.

Blogs on TSNAXIP1

There are no specific blogs for TSNAXIP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSNAXIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSNAXIP1