TSKS Antibody (2E9) Summary
Immunogen |
TSKS (NP_068379, 471 a.a. ~ 560 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDH |
Specificity |
TSKS - testis-specific kinase substrate (2E9) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
TSKS |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Sandwich ELISA
|
Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TSKS Antibody (2E9)
Background
This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Am, Bv, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for TSKS Antibody (H00060385-M01) (0)
There are no publications for TSKS Antibody (H00060385-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TSKS Antibody (H00060385-M01) (0)
There are no reviews for TSKS Antibody (H00060385-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TSKS Antibody (H00060385-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional TSKS Products
Bioinformatics Tool for TSKS Antibody (H00060385-M01)
Discover related pathways, diseases and genes to TSKS Antibody (H00060385-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for TSKS Antibody (H00060385-M01)
Discover more about diseases related to TSKS Antibody (H00060385-M01).
| | Pathways for TSKS Antibody (H00060385-M01)
View related products by pathway.
|
PTMs for TSKS Antibody (H00060385-M01)
Learn more about PTMs related to TSKS Antibody (H00060385-M01).
| | Research Areas for TSKS Antibody (H00060385-M01)
Find related products by research area.
|
Blogs on TSKS