TSKS Antibody (2E9) - Azide and BSA Free

Western Blot: TSKS Antibody (2E9) [H00060385-M01] - Analysis of TSKS expression in transfected 293T cell line by TSKS monoclonal antibody (M01), clone 2E9.Lane 1: TSKS transfected lysate (Predicted MW: 64.7 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: TSKS Antibody (2E9) [H00060385-M01] - Detection limit for recombinant GST tagged TSKS is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TSKS Antibody (2E9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse TSKS Antibody (2E9) - Azide and BSA Free (H00060385-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TSKS (NP_068379, 471 a.a. ~ 560 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDH
• Specificity: TSKS - testis-specific kinase substrate (2E9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TSKS
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSKS Antibody (2E9) - Azide and BSA Free

• STK22 substrate 1
• STK22S1
• testis specific serine/threonine kinase substrate
• Testis-specific kinase substrate
• testis-specific serine kinase substrate
• TSKS1
• TSSKS

Background

This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSKS
• Entrez:
  • 60385(Human)
• Uniprot:
  • NP_068379(Human)