TSKS Antibody (2E9)

Images

 
Western Blot: TSKS Antibody (2E9) [H00060385-M01] - Analysis of TSKS expression in transfected 293T cell line by TSKS monoclonal antibody (M01), clone 2E9.Lane 1: TSKS transfected lysate (Predicted MW: 64.7 KDa).Lane 2: ...read more
Sandwich ELISA: TSKS Antibody (2E9) [H00060385-M01] - Detection limit for recombinant GST tagged TSKS is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2E9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TSKS Antibody (2E9) Summary

Immunogen
TSKS (NP_068379, 471 a.a. ~ 560 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDH
Specificity
TSKS - testis-specific kinase substrate (2E9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TSKS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSKS Antibody (2E9)

  • STK22 substrate 1
  • STK22S1
  • testis specific serine/threonine kinase substrate
  • Testis-specific kinase substrate
  • testis-specific serine kinase substrate
  • TSKS1
  • TSSKS

Background

This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00083942-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
H00023617-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
H00083983-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NB300-721
Species: Am, Bv, Ch, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-82756
Species: Hu
Applications: IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00005564-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for TSKS Antibody (H00060385-M01) (0)

There are no publications for TSKS Antibody (H00060385-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSKS Antibody (H00060385-M01) (0)

There are no reviews for TSKS Antibody (H00060385-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSKS Antibody (H00060385-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSKS Products

Bioinformatics Tool for TSKS Antibody (H00060385-M01)

Discover related pathways, diseases and genes to TSKS Antibody (H00060385-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSKS Antibody (H00060385-M01)

Discover more about diseases related to TSKS Antibody (H00060385-M01).
 

Pathways for TSKS Antibody (H00060385-M01)

View related products by pathway.

PTMs for TSKS Antibody (H00060385-M01)

Learn more about PTMs related to TSKS Antibody (H00060385-M01).
 

Research Areas for TSKS Antibody (H00060385-M01)

Find related products by research area.

Blogs on TSKS

There are no specific blogs for TSKS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSKS Antibody (2E9) and receive a gift card or discount.

Bioinformatics

Gene Symbol TSKS
Entrez
Uniprot