TSGA10 Antibody (6E8)

Images

 
Western Blot: TSGA10 Antibody (6E8) [H00080705-M08] - Analysis of TSGA10 expression in transfected 293T cell line by TSGA10 monoclonal antibody (M08), clone 6E8. Lane 1: TSGA10 transfected lysatE (81.4 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: TSGA10 Antibody (6E8) [H00080705-M08] - Analysis of monoclonal antibody to TSGA10 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: TSGA10 Antibody (6E8) [H00080705-M08] - analysis of TSGA10 over-expressed 293 cell line, cotransfected with TSGA10 Validated Chimera RNAi or non-transfected control. Blot probed with H00080705-M08. GAPDH ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, KD
Clone
6E8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TSGA10 Antibody (6E8) Summary

Immunogen
TSGA10 (NP_079520, 599 a.a. ~ 698 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF
Specificity
TSGA10 - testis specific, 10
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TSGA10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Knockdown Validated
  • Western Blot 1:500RNAi Validation
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It has also been used for RNAi validation.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSGA10 Antibody (6E8)

  • cancer/testis antigen 79
  • CEP4LCT79
  • Testis development protein NYD-SP7
  • testis specific, 10
  • testis-specific gene 10 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1063
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP3-06300
Species: Hu
Applications: ICC/IF, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
H00058524-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-90195
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-38937
Species: Hu
Applications: IHC, IHC-P
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-44579
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
NB300-232
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB110-97871
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00006296-D01P
Species: Hu, Mu
Applications: WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00080705-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, KD

Publications for TSGA10 Antibody (H00080705-M08) (0)

There are no publications for TSGA10 Antibody (H00080705-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSGA10 Antibody (H00080705-M08) (0)

There are no reviews for TSGA10 Antibody (H00080705-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSGA10 Antibody (H00080705-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSGA10 Products

Bioinformatics Tool for TSGA10 Antibody (H00080705-M08)

Discover related pathways, diseases and genes to TSGA10 Antibody (H00080705-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSGA10 Antibody (H00080705-M08)

Discover more about diseases related to TSGA10 Antibody (H00080705-M08).
 

Pathways for TSGA10 Antibody (H00080705-M08)

View related products by pathway.

Blogs on TSGA10

There are no specific blogs for TSGA10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSGA10 Antibody (6E8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TSGA10
Entrez
OMIM
Uniprot