We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Tryptase alpha/beta 1 His Protein

Images

 
SDS-Page of Recombinant Human Tryptase alpha/beta 1 His Protein

Product Details

Summary
Reactivity HuSpecies Glossary
Applications PAGE
Concentration
1 mg/ml

Order Details

Recombinant Human Tryptase alpha/beta 1 His Protein Summary

Description
A denatured recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 31-275 of Human Tryptase alpha/beta 1 (Uniprot: Q15661)

Source: E.coli

Amino Acid Sequence: IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

Source
E. coli
Protein/Peptide Type
Recombinant Protein
Gene
TPSAB1
Purity
>85%, by SDS-PAGE

Applications/Dilutions

Dilutions
  • SDS-PAGE
Application Notes
Denatured protein is most likely not the best option for functional studies. It is better suited for Western Blot (WB) or imaging assays.
Theoretical MW
30.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20 mM Tris-HCl buffer (pH8.0), 10% glycerol, 0.4M UREA
Preservative
No Preservative
Concentration
1 mg/ml
Purity
>85%, by SDS-PAGE

Alternate Names for Recombinant Human Tryptase alpha/beta 1 His Protein

  • alpha-Tryptase
  • EC:3.4.21.59
  • epididymis secretory sperm binding protein
  • mast cell alpha II tryptase
  • mast cell beta I tryptase
  • mast cell tryptase
  • TPS1
  • TPS2
  • TPSAB1
  • TPSB1
  • TPSB2
  • Tryptase 1
  • tryptase alpha II
  • Tryptase alpha
  • Tryptase alpha-1
  • tryptase beta I
  • tryptase beta-1
  • Tryptase beta-2
  • Tryptase I
  • tryptase II
  • tryptase-1
  • tryptase-2
  • tryptase-I
  • tryptase-III

Background

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, alpha and beta 1. Beta tryptases appear to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01679
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP3-45748
Species: Hu, Mu
Applications: ELISA, IHC, IP, WB
NBP2-33660
Species: Hu
Applications: IHC,  IHC-P
NBP2-48756
Species: Hu
Applications: IHC,  IHC-P
NB100-108
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
255-SC
Species: Hu
Applications: BA
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25488
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
203-IL
Species: Hu
Applications: BA
AF2905
Species: Hu
Applications: ELISA, ICC, WB
NBP2-22894
Species: Hu
Applications: PAGE

Publications for Tryptase alpha/beta 1 Recombinant Protein (NBP2-22894) (0)

There are no publications for Tryptase alpha/beta 1 Recombinant Protein (NBP2-22894).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptase alpha/beta 1 Recombinant Protein (NBP2-22894) (0)

There are no reviews for Tryptase alpha/beta 1 Recombinant Protein (NBP2-22894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tryptase alpha/beta 1 Recombinant Protein (NBP2-22894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tryptase alpha/beta 1 Products

Blogs on Tryptase alpha/beta 1

There are no specific blogs for Tryptase alpha/beta 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Tryptase alpha/beta 1 His Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TPSAB1
Uniprot