Recombinant Human Tryptase alpha/beta 1 His Protein

SDS-Page of Recombinant Human Tryptase alpha/beta 1 His Protein

• Reactivity: Hu
• Applications: PAGE
• Concentration: 1 mg/ml

Recombinant Human Tryptase alpha/beta 1 His Protein Summary

• Description: A denatured recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 31-275 of Human Tryptase alpha/beta 1 (Uniprot: Q15661)
  
  

  Source: E.coli

  Amino Acid Sequence: IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: TPSAB1
• Purity: >85%, by SDS-PAGE

Applications/Dilutions

• Dilutions:
  • SDS-Page
• Application Notes: Denatured protein is most likely not the best option for functional studies. It is better suited for Western Blot (WB) or imaging assays.
• Theoretical MW: 30.1 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20 mM Tris-HCl buffer (pH8.0), 10% glycerol, 0.4M UREA
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: >85%, by SDS-PAGE

Alternate Names for Recombinant Human Tryptase alpha/beta 1 His Protein

• alpha-Tryptase
• EC:3.4.21.59
• epididymis secretory sperm binding protein
• mast cell alpha II tryptase
• mast cell beta I tryptase
• mast cell tryptase
• TPS1
• TPS2
• TPSAB1
• TPSB1
• TPSB2
• Tryptase 1
• tryptase alpha II
• Tryptase alpha
• Tryptase alpha-1
• tryptase beta I
• tryptase beta-1
• Tryptase beta-2
• Tryptase I
• tryptase II
• tryptase-1
• tryptase-2
• tryptase-I
• tryptase-III

Background

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, alpha and beta 1. Beta tryptases appear to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TPSAB1
• Uniprot:
  • P20231()
  • Q15661(Human)