Reactivity | Mu, RtSpecies Glossary |
Applications | WB, ELISA |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Janelia Fluor 525 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Troponin I type 2 (fast skeletal) (Troponin I type 2 (fast skeletal) (TNNI2)) (NP_003273.1). Sequence: MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TNNI2 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Optimal dilution of this antibody should be experimentally determined. |
Storage | Store at 4C in the dark. |
Buffer | 50mM Sodium Borate |
Preservative | 0.05% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Troponin I type 2 (fast skeletal) Antibody (NBP3-38486JF525)Find related products by research area.
|
Troponin I Type 2 - I stay with fast-twitch skeletal muscles only The protein Troponin I is a component of the heteromeric protein complex responsible for regulating both skeletal and cardiac muscle contraction. Troponin complex is made up of three parts: troponin I (TnI), troponin T (TnT), and troponin C (TnC). Eac... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TNNI2 |