Troponin I type 2 (fast skeletal) Antibody [DyLight 650]

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

Troponin I type 2 (fast skeletal) Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Troponin I type 2 (fast skeletal) (Troponin I type 2 (fast skeletal) (TNNI2)) (NP_003273.1).
  
  Sequence:
  MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNNI2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Troponin I type 2 (fast skeletal) Antibody [DyLight 650]

• skeletal, fast
• troponin I type 2 (skeletal, fast)
• troponin I, fast skeletal muscle
• Troponin I, fast-twitch isoform
• troponin I, fast-twitch skeletal muscle isoform

Background

The troponin I type 2 gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNNI2