Recombinant Human TRIM40 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRIM40 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 258 of Human TRIM40 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TRIM40

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIM40 Protein

  • RING finger protein 35
  • ring finger RNF35
  • RNF35ring finger protein 40
  • tripartite motif containing 40
  • tripartite motif-containing 40
  • tripartite motif-containing protein 40

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-80535
Species: Hu
Applications: WB
NBP1-83494
Species: Hu
Applications: IHC, IHC-P
NBP2-20704
Species: Hu
Applications: WB, ICC/IF
NBP1-76279
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
MAB342
Species: Hu
Applications: WB, AgAct
NBP2-56883
Species: Hu
Applications: ICC/IF
NBP2-13464
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5725
Species: Hu
Applications: WB, IHC
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-90578
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49627
Species: Hu
Applications: WB, IHC
MAB3428
Species: Hu
Applications: WB, IHC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for TRIM40 Recombinant Protein (H00135644-P01) (0)

There are no publications for TRIM40 Recombinant Protein (H00135644-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM40 Recombinant Protein (H00135644-P01) (0)

There are no reviews for TRIM40 Recombinant Protein (H00135644-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM40 Recombinant Protein (H00135644-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM40 Products

Bioinformatics Tool for TRIM40 Recombinant Protein (H00135644-P01)

Discover related pathways, diseases and genes to TRIM40 Recombinant Protein (H00135644-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM40 Recombinant Protein (H00135644-P01)

Discover more about diseases related to TRIM40 Recombinant Protein (H00135644-P01).
 

Pathways for TRIM40 Recombinant Protein (H00135644-P01)

View related products by pathway.

Research Areas for TRIM40 Recombinant Protein (H00135644-P01)

Find related products by research area.

Blogs on TRIM40

There are no specific blogs for TRIM40, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRIM40 Antibody
NBP1-92530

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIM40 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM40