Trim11 Antibody


Western Blot: Trim11 Antibody [NBP1-74193] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

Product Details

Product Discontinued
View other related Trim11 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Trim11 Antibody Summary

Synthetic peptides corresponding to the C terminal of Trim11. Immunizing peptide sequence GSFYNSNEPAFSPLRDPPKRVGIFLDYEAGHLSFYSATDGSLLFIFPETL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Trim11 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Trim11 Antibody

  • BIA1
  • EC 6.3.2.-
  • Protein BIA1
  • RING finger protein 92
  • RNF92E3 ubiquitin-protein ligase TRIM11
  • tripartite motif containing 11
  • tripartite motif-containing 11
  • Tripartite motif-containing protein 11


Trim11 is an E3 ubiquitin-protein ligase that promotes the degradation of insoluble ubiquitinated proteins, including insoluble PAX6, poly-Gln repeat expanded HTT and poly-Ala repeat expanded ARX. Mediates PAX6 ubiquitination leading to proteasomal degradation, thereby modulating cortical neurogenesis. It may also inhibit PAX6 transcriptional activity, possibly in part by preventing the binding of PAX6 to its consensus sequences. It may contribute to the regulation of the intracellular level of HN (humanin) or HN-containing proteins through the proteasomal degradation pathway. It mediates MED15 ubiquitination leading to proteasomal degradation. Trim11 may contribute to the innate restriction of retroviruses. Upon overexpression, reduces HIV-1 and murine leukemia virus infectivity, by suppressing viral gene expression. Antiviral activity depends on a functional E3 ubiquitin-protein ligase domain. Trim11 may regulate TRIM5 turnover via the proteasome pathway, thus counteracting the TRIM5-mediated cross-species restriction of retroviral infection at early stages of the retroviral life cycle.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC

Publications for Trim11 Antibody (NBP1-74193) (0)

There are no publications for Trim11 Antibody (NBP1-74193).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Trim11 Antibody (NBP1-74193) (0)

There are no reviews for Trim11 Antibody (NBP1-74193). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Trim11 Antibody (NBP1-74193) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Trim11 Products

Bioinformatics Tool for Trim11 Antibody (NBP1-74193)

Discover related pathways, diseases and genes to Trim11 Antibody (NBP1-74193). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Trim11 Antibody (NBP1-74193)

Discover more about diseases related to Trim11 Antibody (NBP1-74193).

Pathways for Trim11 Antibody (NBP1-74193)

View related products by pathway.

PTMs for Trim11 Antibody (NBP1-74193)

Learn more about PTMs related to Trim11 Antibody (NBP1-74193).

Blogs on Trim11

There are no specific blogs for Trim11, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Trim11 Antibody and receive a gift card or discount.


Gene Symbol TRIM11