Recombinant Human TREX2 Protein

Product Discontinued

Recombinant Human TREX2 Protein Summary

• Description: A full-length recombinant protein with His tag corresponding to the amino acids 1 - 236 of Human TREX2
  
  

  Source: Escherichia coli

  Amino Acid Sequence:MGSSHHHHHHSSGLVPRGSHMSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA

• Preparation Method: Escherichia coli expression system
• Protein/Peptide Type: Recombinant Protein
• Gene: TREX2

Applications/Dilutions

• Dilutions:
  • SDS-Page
• Application Notes: This product is useful for SDS-PAGE.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: In 20 mM Tris-HCl, 0.2 M NaCl, pH 8.0 (5 mM dithiothreitol, 30% glycerol)
• Preservative: No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TREX2 Protein

• 3'-5' exonuclease TREX2
• EC 3.1.11.2
• three prime repair exonuclease 2,3'-5' exonuclease TREX2 long form

Background

Please note, this product is one of a range of Aspiring Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot. However no additional claims are made for their ability to recognise native protein in any application.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TREX2