Recombinant Human TRDD3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRDD3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-296 of Human TRDD3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLFSSLLCVFVAFSYSGSSVAQKVTQAQSSVSMPVRKEVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGESFLPFRGNFHYTDKLIFGKGTRVTVEPRSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTRSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TRDD3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRDD3 Protein

  • T cell receptor delta diversity 3
  • TCRD

Background

TRDD3( AAH22317, 1 a.a. - 297 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-74080
Species: Hu
Applications: WB
H00006976-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-45883
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-74190
Species: Mu
Applications: WB, ChIP
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for TRDD3 Recombinant Protein (H00028523-P01) (0)

There are no publications for TRDD3 Recombinant Protein (H00028523-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRDD3 Recombinant Protein (H00028523-P01) (0)

There are no reviews for TRDD3 Recombinant Protein (H00028523-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRDD3 Recombinant Protein (H00028523-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRDD3 Products

Bioinformatics Tool for TRDD3 Recombinant Protein (H00028523-P01)

Discover related pathways, diseases and genes to TRDD3 Recombinant Protein (H00028523-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRDD3 Recombinant Protein (H00028523-P01)

Discover more about diseases related to TRDD3 Recombinant Protein (H00028523-P01).

Blogs on TRDD3

There are no specific blogs for TRDD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRDD3 Antibody
H00028523-B01P
CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRDD3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRDD3