TRAPPC2L Antibody

Images

 
Western Blot: TRAPPC2L Antibody [NBP1-83172] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: TRAPPC2L Antibody [NBP1-83172] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: TRAPPC2L Antibody [NBP1-83172] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Western Blot: TRAPPC2L Antibody [NBP1-83172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAPPC2L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAPPC2L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRAPPC2L Protein (NBP1-83172PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAPPC2L Antibody

  • MGC111156
  • trafficking protein particle complex 2-like
  • trafficking protein particle complex subunit 2-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56481
Species: Hu
Applications: ICC/IF
H00060684-P01
Species: Hu
Applications: WB
H00051112-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IF
AF1936
Species: Hu
Applications: WB, IP
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81422
Species: Hu
Applications: WB, IHC, IHC-P
H00009669-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80880
Species: Hu
Applications: IHC, IHC-P
NBP1-88664
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89052
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRAPPC2L Antibody (NBP1-83172) (0)

There are no publications for TRAPPC2L Antibody (NBP1-83172).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAPPC2L Antibody (NBP1-83172) (0)

There are no reviews for TRAPPC2L Antibody (NBP1-83172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRAPPC2L Antibody (NBP1-83172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAPPC2L Products

Bioinformatics Tool for TRAPPC2L Antibody (NBP1-83172)

Discover related pathways, diseases and genes to TRAPPC2L Antibody (NBP1-83172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAPPC2L Antibody (NBP1-83172)

Discover more about diseases related to TRAPPC2L Antibody (NBP1-83172).

Blogs on TRAPPC2L

There are no specific blogs for TRAPPC2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAPPC2L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAPPC2L