TRAPPC2L Antibody

Images

 
Western Blot: TRAPPC2L Antibody [NBP1-70735] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAPPC2L Antibody Summary

Immunogen
Synthetic peptides corresponding to TRAPPC2L(trafficking protein particle complex 2-like) The peptide sequence was selected from the N terminal of TRAPPC2L. Peptide sequence MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL.
Specificity
This product is specific to Subunit or Isofrom: 2-like protein.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAPPC2L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRAPPC2L and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRAPPC2L Antibody

  • MGC111156
  • trafficking protein particle complex 2-like
  • trafficking protein particle complex subunit 2-like protein

Background

TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56481
Species: Hu
Applications: ICC/IF
H00060684-P01
Species: Hu
Applications: WB
H00051112-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IF
AF1936
Species: Hu
Applications: WB, IP
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81422
Species: Hu
Applications: WB, IHC, IHC-P
H00009669-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80880
Species: Hu
Applications: IHC, IHC-P
NBP1-88664
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89052
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-70735
Species: Hu
Applications: WB

Publications for TRAPPC2L Antibody (NBP1-70735) (0)

There are no publications for TRAPPC2L Antibody (NBP1-70735).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAPPC2L Antibody (NBP1-70735) (0)

There are no reviews for TRAPPC2L Antibody (NBP1-70735). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAPPC2L Antibody (NBP1-70735) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAPPC2L Products

Bioinformatics Tool for TRAPPC2L Antibody (NBP1-70735)

Discover related pathways, diseases and genes to TRAPPC2L Antibody (NBP1-70735). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAPPC2L Antibody (NBP1-70735)

Discover more about diseases related to TRAPPC2L Antibody (NBP1-70735).

Blogs on TRAPPC2L

There are no specific blogs for TRAPPC2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAPPC2L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAPPC2L