TRAILR1/TNFRSF10A Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TRAILR1/TNFRSF10A Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAIL R1/TNFRSF10A.

  Source: E. coli

  Amino Acid Sequence: ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TNFRSF10A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56818.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRAILR1/TNFRSF10A Recombinant Protein Antigen

• APO2
• CD261 antigen
• CD261
• cytotoxic TRAIL receptor
• Death receptor 4
• DR4 TRAIL receptor 1
• DR4
• TNF-related apoptosis inducing ligand receptor 1
• TNF-related apoptosis-inducing ligand receptor 1
• TNFRSF10A
• TRAIL R1
• TRAILR1
• TRAIL-R1
• TRAILR-1
• TRAILR1MGC9365
• tumor necrosis factor receptor superfamily member 10A
• tumor necrosis factor receptor superfamily, member 10a

Background

TRAIL-R1 (CD261, DR4) is a type I transmembrane protein, also called TRAIL receptor 1. The ligand for this DR4 death receptor has been identified and termed TRAIL, which is a member of the TNF family. DR4, as many other receptors (Fas, TNFR1, etc.), mediates apoptosis and NF kappaB activation in many cells and tissues. Apoptosis, a programmed cell death, is a operating process in normal cellular differentiation and development of multicellular organisms. Apoptosis is induced by coupled of certain cytokines (TNF family - TNF, Fas ligand) and their death domain containing receptors (TNFR1, Fas receptor).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TNFRSF10A