TRAILR1/TNFRSF10A Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAIL R1/TNFRSF10A. Source: E. coli Amino Acid Sequence: ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TNFRSF10A |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56818. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TRAILR1/TNFRSF10A Recombinant Protein Antigen
Background
TRAIL-R1 (CD261, DR4) is a type I transmembrane protein, also called TRAIL receptor 1. The ligand for this DR4 death receptor has been identified and termed TRAIL, which is a member of the TNF family. DR4, as many other receptors (Fas, TNFR1, etc.), mediates apoptosis and NF kappaB activation in many cells and tissues. Apoptosis, a programmed cell death, is a operating process in normal cellular differentiation and development of multicellular organisms. Apoptosis is induced by coupled of certain cytokines (TNF family - TNF, Fas ligand) and their death domain containing receptors (TNFR1, Fas receptor).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
Species: Hu
Applications: Flow, IHC, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Publications for TRAILR1/TNFRSF10A Recombinant Protein Antigen (NBP2-56818PEP) (0)
There are no publications for TRAILR1/TNFRSF10A Recombinant Protein Antigen (NBP2-56818PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRAILR1/TNFRSF10A Recombinant Protein Antigen (NBP2-56818PEP) (0)
There are no reviews for TRAILR1/TNFRSF10A Recombinant Protein Antigen (NBP2-56818PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TRAILR1/TNFRSF10A Recombinant Protein Antigen (NBP2-56818PEP) (0)
Additional TRAILR1/TNFRSF10A Products
Research Areas for TRAILR1/TNFRSF10A Recombinant Protein Antigen (NBP2-56818PEP)
Find related products by research area.
|
Blogs on TRAILR1/TNFRSF10A