TRA16 Antibody

Images

 
Western Blot: TRA16 Antibody [NBP2-55864] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: TRA16 Antibody [NBP2-55864] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRA16 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGF
Specificity
Specificity of human TRA16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR2C2AP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRA16 Recombinant Protein Antigen (NBP2-55864PEP)

Reactivity Notes

Mouse 86%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TRA16 Antibody

  • nuclear receptor 2C2-associated protein
  • repressor for TR4 transactivation
  • TR4 orphan receptor associated protein TRA16
  • TRA16TR4 orphan receptor-associated 16 kDa protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46228
Species: Hu
Applications: WB, IHC
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-52131
Species: Hu
Applications: IHC, IHC-Fr, PEP-ELISA
H00010178-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-71803
Species: Hu, Mu
Applications: WB, IHC, IP
MAB356
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NLS2007
Species: Hu
Applications: IHC, IHC-P
H00091614-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-55864
Species: Hu
Applications: WB, ICC/IF

Publications for TRA16 Antibody (NBP2-55864) (0)

There are no publications for TRA16 Antibody (NBP2-55864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRA16 Antibody (NBP2-55864) (0)

There are no reviews for TRA16 Antibody (NBP2-55864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRA16 Antibody (NBP2-55864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRA16 Products

Bioinformatics Tool for TRA16 Antibody (NBP2-55864)

Discover related pathways, diseases and genes to TRA16 Antibody (NBP2-55864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRA16 Antibody (NBP2-55864)

Discover more about diseases related to TRA16 Antibody (NBP2-55864).

Blogs on TRA16

There are no specific blogs for TRA16, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRA16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2C2AP