TRA16 Antibody

Images

 
Western Blot: TRA16 Antibody [NBP1-56746] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRA16 Antibody Summary

Immunogen
Synthetic peptides corresponding to TRA16 The peptide sequence was selected from the N terminal of TRA16. Peptide sequence THSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR2C2AP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRA16 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRA16 Antibody

  • nuclear receptor 2C2-associated protein
  • repressor for TR4 transactivation
  • TR4 orphan receptor associated protein TRA16
  • TRA16TR4 orphan receptor-associated 16 kDa protein

Background

TRA16 may act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46228
Species: Hu
Applications: WB, IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
AF6324
Species: Hu
Applications: WB
NBP2-55133
Species: Hu
Applications: WB, ICC/IF
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS2007
Species: Hu
Applications: IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
H00091614-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-56746
Species: Hu
Applications: WB

Publications for TRA16 Antibody (NBP1-56746) (0)

There are no publications for TRA16 Antibody (NBP1-56746).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRA16 Antibody (NBP1-56746) (0)

There are no reviews for TRA16 Antibody (NBP1-56746). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRA16 Antibody (NBP1-56746) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRA16 Products

Bioinformatics Tool for TRA16 Antibody (NBP1-56746)

Discover related pathways, diseases and genes to TRA16 Antibody (NBP1-56746). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRA16 Antibody (NBP1-56746)

Discover more about diseases related to TRA16 Antibody (NBP1-56746).

Blogs on TRA16

There are no specific blogs for TRA16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRA16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2C2AP
Uniprot