Recombinant Human TOMM22 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TOMM22 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-142 of Human TOMM22 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TOMM22
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
41.36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TOMM22 Protein

  • 1C9-2
  • hTom22
  • mitochondrial import receptor subunit TOM22 homolog
  • mitochondrial import receptor Tom22
  • MST065
  • TOM22MSTP065
  • Translocase of outer membrane 22 kDa subunit homolog
  • translocase of outer mitochondrial membrane 22 homolog (yeast)

Background

TOMM22( AAH09363, 1 a.a. - 143 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87863
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65485
Species: Hu
NBP1-05162
Species: Hu
Applications: ELISA, ICC/IF
NBP1-89771
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3145
Species: Hu
Applications: WB
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-38791
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-695
Species: Hu, Av, Bv, Fi, Ma, Re
Applications: WB, ELISA, IHC
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TOMM22 Recombinant Protein (H00056993-P01) (0)

There are no publications for TOMM22 Recombinant Protein (H00056993-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOMM22 Recombinant Protein (H00056993-P01) (0)

There are no reviews for TOMM22 Recombinant Protein (H00056993-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOMM22 Recombinant Protein (H00056993-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for TOMM22 Recombinant Protein (H00056993-P01)

Discover related pathways, diseases and genes to TOMM22 Recombinant Protein (H00056993-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM22 Recombinant Protein (H00056993-P01)

Discover more about diseases related to TOMM22 Recombinant Protein (H00056993-P01).
 

Pathways for TOMM22 Recombinant Protein (H00056993-P01)

View related products by pathway.

Research Areas for TOMM22 Recombinant Protein (H00056993-P01)

Find related products by research area.

Blogs on TOMM22

There are no specific blogs for TOMM22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TOMM20 Antibody
NBP1-81556
TOMM22 Antibody
NBP1-80671

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TOMM22 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TOMM22