| Description | A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-145 of Human TOMM20 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein is not active and should not be used for experiments requiring activity. |
| Protein/Peptide Type | Recombinant Protein |
| Gene | TOMM20 |
| Dilutions |
|
|
| Application Notes | Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
|
| Publications |
|
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Publication using H00009804-P01 | Applications | Species |
|---|---|---|
| Zhou C, Huang Y, Shao Y et al. The kinase domain of mitochondrial PINK1 faces the cytoplasm. Proc Natl Acad Sci U S A 2008-08-19 [PMID: 18687899] |
Research Areas for TOMM20 Recombinant Protein (H00009804-P01)Find related products by research area.
|
|
Parkin - Role in Mitochondrial Quality Control and Parkinson's Disease Parkin/PARK2 is a cytosolic enzyme which gets recruited to cellular mitochondria damaged through depolarization, ROS or unfolded proteins accumulation, and exert protective effects by inducing mitophagy (mitochondrial autophagy). Parkin induces mit... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TOMM20 |
![C1qTNF1/CTRP1 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "C1qTNF1/CTRP1 Antibody [Unconjugated]")
