TOMM20 Recombinant Protein Antigen

Images

 
There are currently no images for TOMM20 Protein (NBP1-81556PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TOMM20 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOMM20.

Source: E. coli

Amino Acid Sequence: KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOMM20
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81556.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TOMM20 Recombinant Protein Antigen

  • KIAA0016Outer mitochondrial membrane receptor Tom20
  • MAS20
  • MGC117367
  • mitochondrial 20 kDa outer membrane protein
  • mitochondrial import receptor subunit TOM20 homolo
  • mitochondrial import receptor subunit TOM20 homolog
  • MOM19
  • outer mitochondrial membrane receptor Tom20
  • TOM20
  • TOMM20
  • translocase of outer mitochondrial membrane 20 hom
  • translocase of outer mitochondrial membrane 20 homolog (yeast)
  • translocase of outer mitochondrial membrane 20 homolog type II

Background

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80671
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-38289
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92298
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87408
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
NBP1-80681
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00892
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86422
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-44318
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF3145
Species: Hu
Applications: WB
NBP3-45163
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-89125
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-71648
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for TOMM20 Protein (NBP1-81556PEP) (0)

There are no publications for TOMM20 Protein (NBP1-81556PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOMM20 Protein (NBP1-81556PEP) (0)

There are no reviews for TOMM20 Protein (NBP1-81556PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TOMM20 Protein (NBP1-81556PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOMM20 Products

Research Areas for TOMM20 Protein (NBP1-81556PEP)

Find related products by research area.

Blogs on TOMM20.

Parkin - Role in Mitochondrial Quality Control and Parkinson's Disease
Parkin/PARK2 is a cytosolic enzyme which gets recruited to cellular mitochondria damaged through depolarization, ROS or unfolded proteins accumulation, and exert protective effects by inducing mitophagy (mitochondrial autophagy). Parkin induces mit...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TOMM20 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TOMM20