Recombinant Human TNP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TNP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 20090 of Human TNP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TNP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TNP1 Protein

  • spermatid nuclear transition protein 1
  • STP-1
  • TP1
  • TP-1
  • transition protein 1 (during histone to protamine replacement)

Background

Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-07755
Species: Hu
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-77285
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-32841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF

Publications for TNP1 Partial Recombinant Protein (H00007141-Q01) (0)

There are no publications for TNP1 Partial Recombinant Protein (H00007141-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNP1 Partial Recombinant Protein (H00007141-Q01) (0)

There are no reviews for TNP1 Partial Recombinant Protein (H00007141-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNP1 Partial Recombinant Protein (H00007141-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TNP1 Products

Bioinformatics Tool for TNP1 Partial Recombinant Protein (H00007141-Q01)

Discover related pathways, diseases and genes to TNP1 Partial Recombinant Protein (H00007141-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNP1 Partial Recombinant Protein (H00007141-Q01)

Discover more about diseases related to TNP1 Partial Recombinant Protein (H00007141-Q01).
 

Pathways for TNP1 Partial Recombinant Protein (H00007141-Q01)

View related products by pathway.

PTMs for TNP1 Partial Recombinant Protein (H00007141-Q01)

Learn more about PTMs related to TNP1 Partial Recombinant Protein (H00007141-Q01).

Blogs on TNP1

There are no specific blogs for TNP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TNP1 Antibody
NBP2-30567

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TNP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNP1