Recombinant Human TNFAIP8L2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TNFAIP8L2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-184 of Human TNFAIP8L2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL

Protein/Peptide Type
Recombinant Protein
Gene
TNFAIP8L2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TNFAIP8L2 Protein

  • FLJ23467
  • Inflammation factor protein 20
  • TIPE2inflammation factor 20
  • TNF alpha-induced protein 8-like protein 2
  • TNFAIP8-like protein 2
  • tumor necrosis factor alpha-induced protein 8-like protein 2
  • tumor necrosis factor, alpha-induced protein 8-like 2
  • tumor necrosis factor, alpha-induced protein 8-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00079626-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TNFAIP8L2 Recombinant Protein (H00079626-P01) (0)

There are no publications for TNFAIP8L2 Recombinant Protein (H00079626-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNFAIP8L2 Recombinant Protein (H00079626-P01) (0)

There are no reviews for TNFAIP8L2 Recombinant Protein (H00079626-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNFAIP8L2 Recombinant Protein (H00079626-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TNFAIP8L2 Products

Bioinformatics Tool for TNFAIP8L2 Recombinant Protein (H00079626-P01)

Discover related pathways, diseases and genes to TNFAIP8L2 Recombinant Protein (H00079626-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNFAIP8L2 Recombinant Protein (H00079626-P01)

Discover more about diseases related to TNFAIP8L2 Recombinant Protein (H00079626-P01).
 

Pathways for TNFAIP8L2 Recombinant Protein (H00079626-P01)

View related products by pathway.

PTMs for TNFAIP8L2 Recombinant Protein (H00079626-P01)

Learn more about PTMs related to TNFAIP8L2 Recombinant Protein (H00079626-P01).

Blogs on TNFAIP8L2

There are no specific blogs for TNFAIP8L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TNFAIP8L2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFAIP8L2