TMX2 Recombinant Protein Antigen

Images

 
There are currently no images for TMX2 Protein (NBP1-87305PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TMX2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMX2.

Source: E. coli

Amino Acid Sequence: YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TMX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87305.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TMX2 Recombinant Protein Antigen

  • Cell proliferation-inducing gene 26 protein
  • DKFZp781O2021
  • growth-inhibiting gene 11
  • MGC111151
  • PDIA12
  • PIG26
  • protein disulfide isomerase family A, member 12
  • thioredoxin domain containing 14
  • Thioredoxin domain-containing protein 14
  • thioredoxin-related transmembrane protein 2
  • TXNDC14

Background

TMX2 is a gene that codes for a widely expressed single-pass type 1 membrane protein that has two isoforms, with lengths of 296 and 258 amino acids, and weights of approximately 34 and 30 kDa respectively. TMX2 has been shown to have interactions with COMMD8, TMX1, TMX3, CANX, and TMX4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87306
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80306
Species: Av, Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-47801
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92550
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-85158
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87305PEP
Species: Hu
Applications: AC

Publications for TMX2 Protein (NBP1-87305PEP) (0)

There are no publications for TMX2 Protein (NBP1-87305PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMX2 Protein (NBP1-87305PEP) (0)

There are no reviews for TMX2 Protein (NBP1-87305PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TMX2 Protein (NBP1-87305PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMX2 Products

Blogs on TMX2

There are no specific blogs for TMX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TMX2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TMX2