TMPRSS11E Recombinant Protein Antigen

Images

 
There are currently no images for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TMPRSS11E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMPRSS11E.

Source: E. coli

Amino Acid Sequence: VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TMPRSS11E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48995.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TMPRSS11E Recombinant Protein Antigen

  • DESC1
  • FLJ75331
  • FLJ94490
  • MGC141972
  • MGC141974
  • serine 11E2
  • serine protease DESC1
  • TMPRSS11E2
  • transmembrane protease serine 11E
  • transmembrane protease serine 11E2
  • transmembrane protease, serine 11E
  • UNQ742/PRO1461

Background

TMPRSS11E is a member of a larger family of membrane attached serine proteases, a poorly defined group that includes TMPRSS11A, B, C, D, E, F, Hepsin, Corin, Matriptase 1, 2 and 3. The highest degree of identity is with TMPRSS11A, which shares 43% identity at the amino acid level. TMPRSS11E has a domain structure of an aminoterminal cytoplasmic domain, followed by a transmembrane domain, a SEA domain (Sea urchin sperm protein, Enterokinase, Agrin), a short spacer, then the trypsin like serine protease domain. The SEA domain is thought to play a role in carbohydrate binding in the analogous protein sequences where it is found, but the role in TMPRSS11E is unclear. The cleavage of the Arg191 Ile192 bond liberates the catalytic domain. TMPRSS11E has been shown to cleave fibronectin, gelatin, casein and pro uPA in vitro, and to form complexes with serpinA5 and serpinE1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

4776-SE
Species: Hu
Applications: EnzAct
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
DY2209
Species: Hu
Applications: ELISA
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
1585-SE
Species: Hu
Applications: EnzAct
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-35158
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-62583
Species: Hu
Applications: WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-46655
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-20984
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, Simple Western, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP2-48995PEP
Species: Hu
Applications: AC

Publications for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP) (0)

There are no publications for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP) (0)

There are no reviews for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMPRSS11E Products

Blogs on TMPRSS11E

There are no specific blogs for TMPRSS11E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TMPRSS11E Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS11E