TMPRSS11E Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMPRSS11E. Source: E. coli
Amino Acid Sequence: VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TMPRSS11E |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48995. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TMPRSS11E Recombinant Protein Antigen
Background
TMPRSS11E is a member of a larger family of membrane attached serine proteases, a poorly defined group that includes TMPRSS11A, B, C, D, E, F, Hepsin, Corin, Matriptase 1, 2 and 3. The highest degree of identity is with TMPRSS11A, which shares 43% identity at the amino acid level. TMPRSS11E has a domain structure of an aminoterminal cytoplasmic domain, followed by a transmembrane domain, a SEA domain (Sea urchin sperm protein, Enterokinase, Agrin), a short spacer, then the trypsin like serine protease domain. The SEA domain is thought to play a role in carbohydrate binding in the analogous protein sequences where it is found, but the role in TMPRSS11E is unclear. The cleavage of the Arg191 Ile192 bond liberates the catalytic domain. TMPRSS11E has been shown to cleave fibronectin, gelatin, casein and pro uPA in vitro, and to form complexes with serpinA5 and serpinE1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: EnzAct
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: AC
Publications for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP) (0)
There are no publications for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP) (0)
There are no reviews for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP) (0)
Additional TMPRSS11E Products
Blogs on TMPRSS11E