TMEM185A Antibody

Western Blot: TMEM185A Antibody [NBP2-85941] - WB Suggested Anti-T185A antibody Titration: 1 ug/mL. Sample Type: Human Thymus Tumor

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TMEM185A Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMEM185A. Peptide sequence: RNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM185A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM185A Antibody

• chromosome X open reading frame 13
• CXorf13
• ee3
• FAM11AMGC118845
• family with sequence similarity 11, member A
• fragile site, folic acid type, rare, fra(X)(q28) F
• FRAXF
• MGC118844
• Protein FAM11A
• transmembrane protein 185A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM185A