TMEM185A Antibody

Images

 
Western Blot: TMEM185A Antibody [NBP2-85941] - WB Suggested Anti-T185A antibody Titration: 1 ug/mL. Sample Type: Human Thymus Tumor

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM185A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMEM185A. Peptide sequence: LNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMT The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM185A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM185A Antibody

  • chromosome X open reading frame 13
  • CXorf13
  • ee3
  • FAM11AMGC118845
  • family with sequence similarity 11, member A
  • fragile site, folic acid type, rare, fra(X)(q28) F
  • FRAXF
  • MGC118844
  • Protein FAM11A
  • transmembrane protein 185A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-84403
Species: Hu
Applications: WB
NBP2-01770
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-16528
Species: Hu
Applications: WB, ICC/IF
NBP2-32630
Species: Hu
Applications: IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
H00006925-M03
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF3537
Species: Hu
Applications: WB, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
NLS2272
Species: Hu, Pm, Pm
Applications: IHC, IHC-P

Publications for TMEM185A Antibody (NBP2-85941) (0)

There are no publications for TMEM185A Antibody (NBP2-85941).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM185A Antibody (NBP2-85941) (0)

There are no reviews for TMEM185A Antibody (NBP2-85941). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM185A Antibody (NBP2-85941) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEM185A Products

Bioinformatics Tool for TMEM185A Antibody (NBP2-85941)

Discover related pathways, diseases and genes to TMEM185A Antibody (NBP2-85941). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM185A Antibody (NBP2-85941)

Discover more about diseases related to TMEM185A Antibody (NBP2-85941).
 

Pathways for TMEM185A Antibody (NBP2-85941)

View related products by pathway.

Blogs on TMEM185A

There are no specific blogs for TMEM185A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM185A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM185A