TMED7 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TMED7 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMED7.
  
  Source: E.coli
  
  Amino Acid Sequence: ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTF
  
  

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TMED7
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90949.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TMED7 Recombinant Protein Antigen

• transmembrane emp24 domain-containing protein 7
• CGI-109
• p27
• transmembrane emp24 protein transport domain containing 7

Background

TMED7 is a gene that codes for a protein with two isoforms measuring 224 and 188 amino acids in length, with weights of approximately 25 and 21 kDa respectively. TMED7 plays a role in vesicular protein trafficking as well as the biosynthesis of secreted cargo. Current research is being done on diseases and disorders related to this gene including leukemia and lung cancer. TMED7 has also been shown to have interactions with IL1R1, IL1RAP, IRAK2, IRAK3, and IRF3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TMED7