TMC6 Antibody - BSA Free

Western Blot: TMC6 Antibody [NBP2-88437] - Host: Rabbit. Target Name: TMC6. Sample Tissue: Human Hela Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

TMC6 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human TMC6. Peptide sequence: TLWRPEGTQSTATLRILASMPSRTIGRSRGAIISQYYNRTVQLRCRSSRP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMC6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TMC6 Antibody - BSA Free

• epidermodysplasia verruciformis 1
• Epidermodysplasia verruciformis protein 1
• EVER1FLJ17776
• EVIN1EV1
• expressed in activated T/LAK lymphocytes
• LAK-4P
• Protein LAK-4
• transmembrane channel-like 6
• transmembrane channel-like protein 6

Background

SUBCELLULAR LOCATION: Endoplasmic reticulum membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed in placenta, prostate, testis, activated T-lymphocytes and lymphokine-activated killer (LAK) lymphocytes. DISEASE: Defects in TMC6 are a cause of epidermodysplasia verruciformis. It is a rare autosomal recessive genodermatosis associated with a high risk of skin carcinoma that results from an abnormal susceptibility to infection by specific human papillomaviruses. Infection leads to persistent wart-like or macular lesions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMC6