Thymopoietin/LAP2 Recombinant Protein Antigen

Images

 
There are currently no images for Thymopoietin/LAP2 Recombinant Protein Antigen (NBP3-21339PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Thymopoietin/LAP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Thymopoietin/LAP2

Source: E.coli

Amino Acid Sequence: IDGPVISESTPIAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDIL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TMPO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21339. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Thymopoietin/LAP2 Recombinant Protein Antigen

  • CMD1T
  • lamina-associated polypeptide 2
  • LAP2PRO0868
  • LEM domain containing 4
  • LEMD4
  • MGC61508
  • Thymopoietin isoform alpha
  • Thymopoietin
  • Thymopoietin, isoforms beta/gamma
  • Thymopoietin-related peptide isoform alpha
  • Thymopoietin-related peptide isoforms beta/gamma
  • TMPO
  • TP alpha
  • TP beta/gamma
  • TP
  • TPRP isoform alpha
  • TPRP isoforms beta/gamma

Background

Lamins are type V intermediate filament proteins and are grouped into constitutively expressed B-type lamins and developmentally regulated A-type lamins. Lamin-binding proteins in the nuclear lamina and the nuclear interior include several protein families and/or types of proteins in higher eukaryotes such as the inner nuclear membrane proteins, lamin B receptor, emerin, and MANI, three isoforms of lamina-associated polypeptide 1 (LAP 1), and several isoforms of LAP 2. Up to six LAP 2 isoforms derive from a single gene by alternative splicing in mammals and various isoforms have been described in Xenopus. The best characterized LAP2 isoforms are the inner nuclear membrane protein LAP 2 beta and the nucleoplasmic protein LAP 2 alpha, which are identical in their N-terminal 187-amino acid constant region but differ in their C termini. While LAP 2 beta binds to B-type lamins at the nuclear periphery and was suggested to regulate nuclear lamina growth , LAP 2 alpha specifically interacts with A-type lamins within the nuclear interior as part of a detergent/salt-resistant nucleoskeletal structure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001806-M01
Species: Hu
Applications: DB, ELISA, ICC/IF, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB5170
Species: Hu
Applications: Block, Simple Western, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NLS1049
Species: Eq, Hu, Pm, Po, Pm
Applications: ICC, ICC/IF, IHC,  IHC-P
NBP3-13522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB9080
Species: Hu
Applications: WB
AF2009
Species: Hu
Applications: ICC, IHC
AF2905
Species: Hu
Applications: ELISA, ICC, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP3-21339PEP
Species: Hu
Applications: AC

Publications for Thymopoietin/LAP2 Recombinant Protein Antigen (NBP3-21339PEP) (0)

There are no publications for Thymopoietin/LAP2 Recombinant Protein Antigen (NBP3-21339PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thymopoietin/LAP2 Recombinant Protein Antigen (NBP3-21339PEP) (0)

There are no reviews for Thymopoietin/LAP2 Recombinant Protein Antigen (NBP3-21339PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Thymopoietin/LAP2 Recombinant Protein Antigen (NBP3-21339PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thymopoietin/LAP2 Products

Research Areas for Thymopoietin/LAP2 Recombinant Protein Antigen (NBP3-21339PEP)

Find related products by research area.

Blogs on Thymopoietin/LAP2

There are no specific blogs for Thymopoietin/LAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Thymopoietin/LAP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPO