Thioredoxin-2 Antibody

Product Discontinued

Thioredoxin-2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to TXN2(thioredoxin 2) The peptide sequence was selected from the middle region of TXN2 (NP_036605). Peptide sequence QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ.
• Predicted Species: Mouse (100%), Rat (100%), Canine (93%), Equine (100%), Guinea Pig (100%), Bovine (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TXN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Theoretical MW: 12 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Thioredoxin-2 Antibody

• mitochondrial thioredoxin
• MTRX
• MT-TRX
• thioredoxin 2
• thioredoxin, mitochondrial
• Thioredoxin2
• Thioredoxin-2
• Trx2
• TXN2

Background

TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Thioredoxin-2 Antibody (NBP1-54672)(1)

Publication using NBP1-54672

• Dunn LL, Simpson PJ, Prosser HG et al. A Critical Role for Thioredoxin Interacting Protein in Diabetes-Related Impairment of Angiogenesis. Diabetes. 2013-11-05 [PMID: 24198286]

Bioinformatics

• Gene Symbol: TXN2
• Entrez:
  • 25828(Human)
• Uniprot:
  • Q99757(Human)