Thioredoxin-2 Antibody

Images

 
Western Blot: Thioredoxin-2 Antibody [NBP1-54672] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
LYOPH

Order Details

Thioredoxin-2 Antibody Summary

Immunogen
Synthetic peptides corresponding to TXN2(thioredoxin 2) The peptide sequence was selected from the middle region of TXN2 (NP_036605). Peptide sequence QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TXN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-54672.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
LYOPH
Purity
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Thioredoxin-2 Antibody

  • mitochondrial thioredoxin
  • MTRX
  • MT-TRX
  • thioredoxin 2
  • thioredoxin, mitochondrial
  • Thioredoxin2
  • Thioredoxin-2
  • Trx2
  • TXN2

Background

TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NB600-248
Species: Hu
Applications: WB, IP
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-19777
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF3119
Species: Mu
Applications: WB
H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-90040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54672
Species: Hu
Applications: WB

Publications for Thioredoxin-2 Antibody (NBP1-54672)(1)

Reviews for Thioredoxin-2 Antibody (NBP1-54672) (0)

There are no reviews for Thioredoxin-2 Antibody (NBP1-54672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Thioredoxin-2 Antibody (NBP1-54672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Thioredoxin-2 Products

Bioinformatics Tool for Thioredoxin-2 Antibody (NBP1-54672)

Discover related pathways, diseases and genes to Thioredoxin-2 Antibody (NBP1-54672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thioredoxin-2 Antibody (NBP1-54672)

Discover more about diseases related to Thioredoxin-2 Antibody (NBP1-54672).
 

Pathways for Thioredoxin-2 Antibody (NBP1-54672)

View related products by pathway.

PTMs for Thioredoxin-2 Antibody (NBP1-54672)

Learn more about PTMs related to Thioredoxin-2 Antibody (NBP1-54672).
 

Research Areas for Thioredoxin-2 Antibody (NBP1-54672)

Find related products by research area.

Blogs on Thioredoxin-2

There are no specific blogs for Thioredoxin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Thioredoxin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TXN2
Entrez
Uniprot