THG1L Antibody - BSA Free

Western Blot: THG1L Antibody [NBP1-82314] - Analysis in human cell line Daudi.

Immunohistochemistry-Paraffin: THG1L Antibody [NBP1-82314] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

THG1L Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THG1L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  THG1L Protein (NBP1-82314PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for THG1L Antibody - BSA Free

• EC 2.7.7
• EC 2.7.7.6
• FLJ11601
• FLJ20546
• ICF45EC 2.7.7.-
• Interphase cytoplasmic foci protein 45
• probable tRNA(His) guanylyltransferase
• tRNA-histidine guanylyltransferase 1-like (S. cerevisiae)
• tRNA-histidine guanylyltransferase

Background

Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THG1L
• Entrez:
  • 54974(Human)
• Uniprot:
  • Q9NWX6(Human)