THG1L Antibody

Images

 
Western Blot: THG1L Antibody [NBP1-56583] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THG1L Antibody Summary

Immunogen
Synthetic peptides corresponding to THG1L(tRNA-histidine guanylyltransferase 1-like (S. cerevisiae)) The peptide sequence was selected from the middle region of THG1L. Peptide sequence DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THG1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against THG1L and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for THG1L Antibody

  • EC 2.7.7
  • EC 2.7.7.6
  • FLJ11601
  • FLJ20546
  • ICF45EC 2.7.7.-
  • Interphase cytoplasmic foci protein 45
  • probable tRNA(His) guanylyltransferase
  • tRNA-histidine guanylyltransferase 1-like (S. cerevisiae)
  • tRNA-histidine guanylyltransferase

Background

THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-71648
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-75597
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-56583
Species: Hu
Applications: WB

Publications for THG1L Antibody (NBP1-56583) (0)

There are no publications for THG1L Antibody (NBP1-56583).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THG1L Antibody (NBP1-56583) (0)

There are no reviews for THG1L Antibody (NBP1-56583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for THG1L Antibody (NBP1-56583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for THG1L Antibody (NBP1-56583)

Discover related pathways, diseases and genes to THG1L Antibody (NBP1-56583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on THG1L

There are no specific blogs for THG1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THG1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THG1L
Uniprot