Testisin/Prss21 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Testisin Antibody [NBP1-84789] Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: Testisin Antibody [NBP1-84789] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Testisin/Prss21 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRSS21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Testisin/Prss21 Protein (NBP1-84789PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Testisin/Prss21 Antibody

  • EC 3.4.21
  • Eosinophil serine protease 1
  • ESP1EC 3.4.21.-
  • ESP-1serine protease from eosinophils
  • protease, serine, 21 (testisin)
  • Prss21
  • Serine protease 21
  • TEST1
  • TEST1testisin
  • Testisin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
MAB4457
Species: Hu, Mu, Rt
Applications: WB
AF4599
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-01679
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF1988
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC
NBP2-33867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Testisin/Prss21 Antibody (NBP1-84789) (0)

There are no publications for Testisin/Prss21 Antibody (NBP1-84789).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Testisin/Prss21 Antibody (NBP1-84789) (0)

There are no reviews for Testisin/Prss21 Antibody (NBP1-84789). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Testisin/Prss21 Antibody (NBP1-84789) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Testisin/Prss21 Products

Bioinformatics Tool for Testisin/Prss21 Antibody (NBP1-84789)

Discover related pathways, diseases and genes to Testisin/Prss21 Antibody (NBP1-84789). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Testisin/Prss21 Antibody (NBP1-84789)

Discover more about diseases related to Testisin/Prss21 Antibody (NBP1-84789).
 

Pathways for Testisin/Prss21 Antibody (NBP1-84789)

View related products by pathway.

PTMs for Testisin/Prss21 Antibody (NBP1-84789)

Learn more about PTMs related to Testisin/Prss21 Antibody (NBP1-84789).

Blogs on Testisin/Prss21

There are no specific blogs for Testisin/Prss21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Testisin/Prss21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS21
Entrez