TECPR2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TECPR2 Antibody [NBP1-93642] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TECPR2 Antibody [NBP1-93642] - Staining in human cerebral cortex and colon tissues using anti-TECPR2 antibody. Corresponding TECPR2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: TECPR2 Antibody [NBP1-93642] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: TECPR2 Antibody [NBP1-93642] - Staining of human colon shows low expression as expected.

Product Details

Summary
Reactivity Hu, CaSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TECPR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGTAWEHVPGLQACQLALSTRTVWARCPNGDLARRYGVTDKNPAGDYWKKIPGSVSCFTVTASDELWAVGPPGYLLQRLTKTFSHSHGTQKSSQAAMPHPEDLEDEWEVI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TECPR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TECPR2 Protein (NBP1-93642PEP)
Publications
Read Publication using
NBP1-93642 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%). Canine reactivity reported in scientific literature (PMID: 26555167).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TECPR2 Antibody

  • KIAA0329
  • tectonin beta-propeller repeat containing 2
  • tectonin beta-propeller repeat-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-2331
Species: Hu, Mu, Rt, Am, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
NBP2-02627
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2220
Species: Hu, Mu, Rt, Po, Al, Av, Ba, Bv, Ca, Ch, ChHa, SyHa, Gp, Ha, In, Pm, Pm, Rb, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, PAGE, ChIP, KD, KO

Publications for TECPR2 Antibody (NBP1-93642)(1)

We have publications tested in 1 confirmed species: Canine.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Canine
(1)
All Species

Reviews for TECPR2 Antibody (NBP1-93642) (0)

There are no reviews for TECPR2 Antibody (NBP1-93642). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TECPR2 Antibody (NBP1-93642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TECPR2 Products

Array NBP1-93642

Bioinformatics Tool for TECPR2 Antibody (NBP1-93642)

Discover related pathways, diseases and genes to TECPR2 Antibody (NBP1-93642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TECPR2 Antibody (NBP1-93642)

Discover more about diseases related to TECPR2 Antibody (NBP1-93642).
 

Pathways for TECPR2 Antibody (NBP1-93642)

View related products by pathway.

Blogs on TECPR2

There are no specific blogs for TECPR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TECPR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TECPR2