TEAD4 Antibody [mFluor Violet 610 SE]

Product Discontinued

TEAD4 Antibody [mFluor Violet 610 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human TEAD4 (NP_003204.2).
  
  Sequence:
  AREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEAD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for TEAD4 Antibody [mFluor Violet 610 SE]

• EFTR-2
• hRTEF-1B
• related transcription enhancer factor 1B
• RTEF1RTEF-1
• TCF13L1MGC9014
• TEA domain family member 4TEF3
• TEAD-4
• TEF-3
• TEFR-1
• Transcription factor 13-like 1
• Transcription factor RTEF-1
• transcriptional enhancer factor 1-related
• transcriptional enhancer factor 3
• transcriptional enhancer factor TEF-3

Background

TEAD4 product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEAD4