TDRD1 Antibody


Immunohistochemistry-Paraffin: TDRD1 Antibody [NBP1-84349] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: TDRD1 Antibody [NBP1-84349] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferus ducts and leydig cells.
Immunohistochemistry-Paraffin: TDRD1 Antibody [NBP1-84349] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: TDRD1 Antibody [NBP1-84349] - Staining in human testis and endometrium tissues using anti-TDRD1 antibody. Corresponding TDRD1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TDRD1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TENNIVVDKSDLIPKVLTLNVGDEFCGVVAHIQTPEDFFCQQLQSGRKLAELQASLSKYCDQLPPRSDFYPAIGDICCAQ
Specificity of human TDRD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TDRD1 Protein (NBP1-84349PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TDRD1 Antibody

  • CT41.1
  • CT41.1Cancer/testis antigen 41.1
  • FLJ21082
  • TDRD1
  • tudor domain containing 1
  • tudor domain containing protein 1
  • tudor domain-containing protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Mu
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P

Publications for TDRD1 Antibody (NBP1-84349) (0)

There are no publications for TDRD1 Antibody (NBP1-84349).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDRD1 Antibody (NBP1-84349) (0)

There are no reviews for TDRD1 Antibody (NBP1-84349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TDRD1 Antibody (NBP1-84349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TDRD1 Products

Bioinformatics Tool for TDRD1 Antibody (NBP1-84349)

Discover related pathways, diseases and genes to TDRD1 Antibody (NBP1-84349). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDRD1 Antibody (NBP1-84349)

Discover more about diseases related to TDRD1 Antibody (NBP1-84349).

Pathways for TDRD1 Antibody (NBP1-84349)

View related products by pathway.

PTMs for TDRD1 Antibody (NBP1-84349)

Learn more about PTMs related to TDRD1 Antibody (NBP1-84349).

Blogs on TDRD1

There are no specific blogs for TDRD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TDRD1 Antibody and receive a gift card or discount.


Gene Symbol TDRD1