TDRD1 Antibody

Images

 
Immunohistochemistry-Paraffin: TDRD1 Antibody [NBP1-84349] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferus ducts and leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TDRD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TENNIVVDKSDLIPKVLTLNVGDEFCGVVAHIQTPEDFFCQQLQSGRKLAELQASLSKYCDQLPPRSDFYPAIGDICCAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TDRD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TDRD1 Protein (NBP1-84349PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TDRD1 Antibody

  • CT41.1
  • CT41.1Cancer/testis antigen 41.1
  • FLJ21082
  • TDRD1
  • tudor domain containing 1
  • tudor domain containing protein 1
  • tudor domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6548
Species: Hu, Mu
Applications: IHC
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-24590
Species: Mu
Applications: WB, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
38150002
Species: Hu
Applications: WB, ELISA
NBP1-83782
Species: Hu
Applications: IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP1-49832
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-81971
Species: Hu
Applications: IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-57258
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-27292
Species: Hu
Applications: IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-57116
Species: Hu
Applications: WB
NB100-56641
Species: Hu, Mu
Applications: WB
NBP1-84349
Species: Hu
Applications: IHC, IHC-P

Publications for TDRD1 Antibody (NBP1-84349) (0)

There are no publications for TDRD1 Antibody (NBP1-84349).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDRD1 Antibody (NBP1-84349) (0)

There are no reviews for TDRD1 Antibody (NBP1-84349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TDRD1 Antibody (NBP1-84349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TDRD1 Products

Bioinformatics Tool for TDRD1 Antibody (NBP1-84349)

Discover related pathways, diseases and genes to TDRD1 Antibody (NBP1-84349). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDRD1 Antibody (NBP1-84349)

Discover more about diseases related to TDRD1 Antibody (NBP1-84349).
 

Pathways for TDRD1 Antibody (NBP1-84349)

View related products by pathway.

PTMs for TDRD1 Antibody (NBP1-84349)

Learn more about PTMs related to TDRD1 Antibody (NBP1-84349).

Blogs on TDRD1

There are no specific blogs for TDRD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDRD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TDRD1
Entrez