Home » TDG » TDG Proteins » Recombinant Human TDG Protein

Recombinant Human TDG Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related TDG Peptides and Proteins

Order Details


    • Catalog Number
      H00006996-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TDG Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 312-409 of Human TDG partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESH
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
TDG

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TDG Protein

  • EC 3.2.2.29
  • TDG
  • thymine-DNA glycosylaseG/T mismatch-specific thymine DNA glycosylase

Background

TDG - thymine-DNA glycosylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

UNG Antibody - BSA
Free
NB600-1031
Western Blot UNG Antibody - BSA Free
Immunohistochemistry-Paraffin UNG Antibody - BSA Free
(5 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MBD4 Antibody -
BSA Free
NBP1-91189
Immunocytochemistry/ Immunofluorescence MBD4 Antibody - BSA Free
Immunohistochemistry MBD4 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
APE Antibody
(13B8E5C2) - BSA Free
NB100-116
Immunocytochemistry/ Immunofluorescence APE Antibody (13B8E5C2) - BSA Free
Western Blot APE Antibody (13B8E5C2) - BSA Free
Chromatin Immunoprecipitation (ChIP) APE Antibody (13B8E5C2) - BSA Free
(3 Reviews)
(108 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
SMUG1 Antibody
NB100-1414
Immunocytochemistry/ Immunofluorescence SMUG1 Antibody
Immunocytochemistry/ Immunofluorescence SMUG1 Antibody
Flow Cytometry SMUG1 Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
Galectin-1
Antibody [Unconjugate
AF1152
Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]
Simple Western Galectin-1 Antibody [Unconjugated]
Immunohistochemistry Galectin-1 Antibody [Unconjugated]
(4 Reviews)
(22 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DNA Ligase IV
Antibody - BSA Free
NBP2-16182
Western Blot DNA Ligase IV Antibody - BSA Free
Immunohistochemistry-Paraffin DNA Ligase IV Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence DNA Ligase IV Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SRC1 Antibody
(1135) - Azide and BS ...
NB200-310
Western Blot SRC1 Antibody (1135) - Azide and BSA Free
(1 Review)
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
SUMO3 Antibody
(401513)
MAB2959
Immunocytochemistry SUMO3 Antibody (401513)
(1 Review)
Species: Hu
Applications: ICC
Thymidylate
Synthase Antibody (HL ...
NBP3-25721
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Immunohistochemistry-Paraffin Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MPG Antibody - BSA
Free
NBP1-82787
Western Blot MPG Antibody - BSA Free
Immunohistochemistry-Paraffin MPG Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence MPG Antibody - BSA Free
(2 Reviews)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AICDA Antibody -
BSA Free
NBP1-30955
Immunocytochemistry/ Immunofluorescence AICDA Antibody - BSA Free
Immunohistochemistry-Paraffin AICDA Antibody - BSA Free
Western Blot AICDA Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DNMT1 Antibody
(60B1220.1) - BSA Fre
NB100-56519
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Immunoprecipitation DNMT1 Antibody (60B1220.1) - BSA Free
(4 Reviews)
(144 Publications)
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
SUMO2/3 Antibody
(6R8G7)
NBP3-16540
Immunohistochemistry-Paraffin SUMO2/3 Antibody (6R8G7)
Immunohistochemistry-Paraffin SUMO2/3 Antibody (6R8G7)
Western Blot SUMO2/3 Antibody (6R8G7)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
CBP/KAT3A Antibody
(257003) [Unconjugate ...
MAB2676
Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]
Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB

Publications for TDG Partial Recombinant Protein (H00006996-Q01) (0)

There are no publications for TDG Partial Recombinant Protein (H00006996-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDG Partial Recombinant Protein (H00006996-Q01) (0)

There are no reviews for TDG Partial Recombinant Protein (H00006996-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TDG Partial Recombinant Protein (H00006996-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TDG Products

Research Areas for TDG Partial Recombinant Protein (H00006996-Q01)

Find related products by research area.

Blogs on TDG

There are no specific blogs for TDG, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TDG Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TDG