Recombinant Human TDG Protein

Images

 

Product Details

Summary
Product Discontinued
View other related TDG Peptides and Proteins

Order Details


    • Catalog Number
      H00006996-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TDG Protein Summary

Description
TDG (Human) Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESH
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
TDG

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TDG Protein

  • EC 3.2.2.29
  • TDG
  • thymine-DNA glycosylaseG/T mismatch-specific thymine DNA glycosylase

Background

TDG - thymine-DNA glycosylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NBP1-91189
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1414
Species: Hu
Applications: WB, PEP-ELISA
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-87405
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1489
Species: Hu
Applications: WB
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
MAB2959R
Species: Hu
Applications: ICC
NBP1-36638
Species: Hu
Applications: IHC, IHC-P
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po, Ze
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
A-718
Species: Hu
Applications: WB
NB100-56599
Species: Hu
Applications: WB, Flow
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA

Publications for TDG Partial Recombinant Protein (H00006996-Q01) (0)

There are no publications for TDG Partial Recombinant Protein (H00006996-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDG Partial Recombinant Protein (H00006996-Q01) (0)

There are no reviews for TDG Partial Recombinant Protein (H00006996-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TDG Partial Recombinant Protein (H00006996-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human TDG Protein Products

Related Products by Gene

Bioinformatics Tool for TDG Partial Recombinant Protein (H00006996-Q01)

Discover related pathways, diseases and genes to TDG Partial Recombinant Protein (H00006996-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDG Partial Recombinant Protein (H00006996-Q01)

Discover more about diseases related to TDG Partial Recombinant Protein (H00006996-Q01).
 

Pathways for TDG Partial Recombinant Protein (H00006996-Q01)

View related products by pathway.

PTMs for TDG Partial Recombinant Protein (H00006996-Q01)

Learn more about PTMs related to TDG Partial Recombinant Protein (H00006996-Q01).
 

Research Areas for TDG Partial Recombinant Protein (H00006996-Q01)

Find related products by research area.

Blogs on TDG

There are no specific blogs for TDG, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Recombinant Human TDG Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TDG
Entrez