Recombinant Human TBX22 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TBX22 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 431-519 of Human TBX22 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TBX22

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBX22 Protein

  • cleft palate and/or ankyloglossia
  • CLPA
  • CPX
  • dJ795G23.1
  • T-box 22
  • T-box protein 22
  • T-box transcription factor TBX22
  • TBOX22
  • TBXX

Background

TBX22 - T-box 22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-89557
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
AF4779
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-549
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54851
Species: Hu
Applications: WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP1-89478
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC

Publications for TBX22 Partial Recombinant Protein (H00050945-Q01) (0)

There are no publications for TBX22 Partial Recombinant Protein (H00050945-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBX22 Partial Recombinant Protein (H00050945-Q01) (0)

There are no reviews for TBX22 Partial Recombinant Protein (H00050945-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBX22 Partial Recombinant Protein (H00050945-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBX22 Products

Bioinformatics Tool for TBX22 Partial Recombinant Protein (H00050945-Q01)

Discover related pathways, diseases and genes to TBX22 Partial Recombinant Protein (H00050945-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX22 Partial Recombinant Protein (H00050945-Q01)

Discover more about diseases related to TBX22 Partial Recombinant Protein (H00050945-Q01).
 

Pathways for TBX22 Partial Recombinant Protein (H00050945-Q01)

View related products by pathway.

PTMs for TBX22 Partial Recombinant Protein (H00050945-Q01)

Learn more about PTMs related to TBX22 Partial Recombinant Protein (H00050945-Q01).
 

Research Areas for TBX22 Partial Recombinant Protein (H00050945-Q01)

Find related products by research area.

Blogs on TBX22

There are no specific blogs for TBX22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TBX22 Antibody (1A10)
H00050945-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TBX22 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX22