TBKBP1 Antibody - BSA Free

Western Blot: TBKBP1 Antibody [NBP2-88421] - Host: Rabbit. Target Name: TBKBP1. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TBKBP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBKBP1 Antibody - BSA Free (NBP2-88421) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human TBKBP1. Peptide sequence: ELQKNKEQEEQLGEMIQAYEKLCVEKSDLETELREMRALVETHLRQICGL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBKBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TBKBP1 Antibody - BSA Free

• ProSAPiP2
• SINTBAD
• TBKBP1 TBK1 binding protein 1

Background

TBKBP1 is an adaptor protein that binds to TBK1 (MIM 604834) and is part of the interaction network in the TNF (MIM 191160)/NFKB (see MIM 164011) pathway (Bouwmeester et al., 2004 [PubMed 14743216]). [supplied by OMIM, Mar 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBKBP1