TBC1D7 Antibody - BSA Free

Western Blot: TBC1D7 Antibody [NBP2-85880] - Host: Rabbit. Target Name: Tbc1d7. Sample Type: Mouse Stomach lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TBC1D7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBC1D7 Antibody - BSA Free (NBP2-85880) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse TBC1D7. Peptide sequence: ISRCFVKQLNNKYRDALPQLPKAFEQYLNLEDSRLLSHLKTCSAVSKLPY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBC1D7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TBC1D7 Antibody - BSA Free

• cell migration-inducing protein 23
• dJ257A7.3
• DKFZp686N2317
• FLJ32666
• PIG51
• TBC1 domain family member 7
• TBC1 domain family, member 7
• TBC7
• TCD1D7

Background

TBC1D7 belongs to the family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6; MIM 604334), yeast Bub2, and CDC16 (MIM 603461) (Nakashima et al., 2007 (PubMed 17658474)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBC1D7