TBC1D7 Antibody

Images

 
Western Blot: TBC1D7 Antibody [NBP2-85880] - Host: Rabbit. Target Name: Tbc1d7. Sample Type: Mouse Stomach lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBC1D7 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse TBC1D7. Peptide sequence: ISRCFVKQLNNKYRDALPQLPKAFEQYLNLEDSRLLSHLKTCSAVSKLPY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBC1D7 Antibody

  • cell migration-inducing protein 23
  • dJ257A7.3
  • DKFZp686N2317
  • FLJ32666
  • PIG51
  • TBC1 domain family member 7
  • TBC1 domain family, member 7
  • TBC7
  • TCD1D7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-74653
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB40401
Species: Hu, Mu
Applications: ICC, IHC, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
H00006009-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-80423
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82884
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB300-131
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-66778
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP1-81185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-67584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-78748
Species: Hu
Applications: IP, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB

Publications for TBC1D7 Antibody (NBP2-85880) (0)

There are no publications for TBC1D7 Antibody (NBP2-85880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D7 Antibody (NBP2-85880) (0)

There are no reviews for TBC1D7 Antibody (NBP2-85880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBC1D7 Antibody (NBP2-85880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBC1D7 Products

Bioinformatics Tool for TBC1D7 Antibody (NBP2-85880)

Discover related pathways, diseases and genes to TBC1D7 Antibody (NBP2-85880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D7 Antibody (NBP2-85880)

Discover more about diseases related to TBC1D7 Antibody (NBP2-85880).
 

Pathways for TBC1D7 Antibody (NBP2-85880)

View related products by pathway.

Blogs on TBC1D7

There are no specific blogs for TBC1D7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBC1D7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D7