![Western Blot: TBC1D17 Antibody [NBP2-83622] - Host: Rabbit. Target Name: Tbc1d17. Sample Type: Mouse Thymus lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/TBC1D17 Antibody-Western Blot-NBP2-83622-img0001.jpg "Western Blot: TBC1D17 Antibody [NBP2-83622] - Host: Rabbit. Target Name: Tbc1d17. Sample Type: Mouse Thymus lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | Mu, Hu, Rt, Bv, Ca, Eq, GpSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Mouse TBC1D17. Peptide sequence: FCGFMELVHGNFEESQETMKRQLGQLLLLLRVLDQPLCDFLDSQDSGSLC The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Human (100%), Rat (93%), Canine (93%), Equine (93%), Bovine (93%), Guinea Pig (100%). Backed by our 100% Guarantee. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TBC1D17 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Pathways for TBC1D17 Antibody (NBP2-83622)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TBC1D17 |
![Western Blot: USP6NL Antibody [NBP2-20839] - Sample (30 ug of whole cell lysate) A: A431 B: Jurkat 7. 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/USP6NL Antibody-Western Blot-NBP2-20839-img0001.jpg)
![Western Blot: Optineurin Antibody [NBP1-84682] - Analysis in human cell lines A-431 and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.](http://images.novusbio.com/images2/Optineurin-Antibody-Western-Blot-NBP1-84682-img0018.jpg)
![Western Blot: Optineurin Antibody [NBP1-84682] - Analysis using Anti-OPTN antibody NBP1-84682 (A) shows similar pattern to independent antibody NBP1-84683 (B).](http://images.novusbio.com/images2/Optineurin-Antibody-Western-Blot-NBP1-84682-img0023.jpg)
![Immunocytochemistry/Immunofluorescence: Optineurin Antibody [NBP1-84682] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining shown in green.](http://images.novusbio.com/images2/Optineurin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84682-img0012.jpg)
![Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://images.novusbio.com/images2/SGSM3-Antibody-Western-Blot-NBP2-13304-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.](http://images.novusbio.com/images2/SGSM3 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13304-img0005.jpg)
![Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/SGSM3-Antibody-Immunohistochemistry-Paraffin-NBP2-13304-img0001.jpg)
![Western Blot: RAB6A Antibody [NBP1-33110] - A. 50 ug mouse brain lysate/extract 12 % SDS-PAGE RAB6A antibody dilution: :1000](http://images.novusbio.com/images2/RAB6A-Antibody-Western-Blot-NBP1-33110-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.](http://images.novusbio.com/images2/RAB6A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33110-img0007.jpg)
![Immunohistochemistry-Paraffin: RAB6A Antibody [NBP1-33110] - Paraffin-embedded MDA-MB-468 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/RAB6A Antibody-Immunohistochemistry-Paraffin-NBP1-33110-img0005.jpg)
![Western Blot: Rab5a Antibody [NB120-13253] - analysis of Human Cell line lysates showing detection of Rab5 protein using Rabbit Anti-Rab5 Polyclonal Antibody. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Donkey Anti-Rabbit IgG: HRP for 1 hour at RT.](http://images.novusbio.com/images2/Rab5a-Antibody-Western-Blot-NB120-13253-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: Rab5a Antibody [NB120-13253] - Tissue: HeLa Cells. Species: Human. Fixation: 2% Formaldehyde for 20 min at RT. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:80 for 12 hours at 4C. Secondary Antibody: R-PE Goat Anti-Rabbit (yellow) at 1:200 for 2 hours at RT. Counterstain: DAPI (blue) nuclear stain at 1:40000 for 2 hours at RT. Localization: Cytoplasm. Melanosome. Nucleus. Magnification: 100x.](http://images.novusbio.com/images2/Rab5a-Antibody-Immunocytochemistry-Immunofluorescence-NB120-13253-img0010.jpg)
![Immunohistochemistry-Paraffin: Rab5a Antibody [NB120-13253] - analysis using Rabbit Anti-Rab5 Polyclonal Antibody. Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative Solution. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.](http://images.novusbio.com/images2/Rab5a-Antibody-Immunohistochemistry-Paraffin-NB120-13253-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: EVI5 Antibody [NBP1-82596] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/EVI5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82596-img0005.jpg)
![Immunohistochemistry-Paraffin: EVI5 Antibody [NBP1-82596] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/images2/EVI5-Antibody-Immunohistochemistry-Paraffin-NBP1-82596-img0009.jpg)
![Immunohistochemistry-Paraffin: EVI5 Antibody [NBP1-82596] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.](http://images.novusbio.com/images2/EVI5-Antibody-Immunohistochemistry-Paraffin-NBP1-82596-img0006.jpg)
![Western Blot: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/images2/HIV-1-Rev-binding-protein-(HRB)-Antibody-Western-Blot-NBP1-91991-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.](http://images.novusbio.com/images2/HIV-1 Rev binding protein (HRB) Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91991-img0007.jpg)
![Immunohistochemistry-Paraffin: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/images2/HIV-1-Rev-binding-protein-(HRB)-Antibody-Immunohistochemistry-Paraffin-NBP1-91991-img0001.jpg)
![Western Blot: RAB43 Antibody (5G4) [H00339122-M01] - RAB43 monoclonal antibody (M01), clone 5G4 Analysis of RAB43 expression in HepG2.](http://images.novusbio.com/images2/RAB43 Antibody (5G4)-Western Blot-H00339122-M01-img0007.jpg)
![Immunohistochemistry-Paraffin: RAB43 Antibody (5G4) [H00339122-M01] - Analysis of monoclonal antibody to RAB43 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.](http://images.novusbio.com/images2/RAB43-Antibody-(5G4)-Immunohistochemistry-Paraffin-H00339122-M01-img0005.jpg)
![ELISA: RAB43 Antibody (5G4) [H00339122-M01] - Detection limit for recombinant GST tagged RAB43 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/images2/RAB43-Antibody-(5G4)-ELISA-H00339122-M01-img0008.jpg)
![Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.](http://images.novusbio.com/images2/RAB8A-Antibody-(3G1)-Western-Blot-H00004218-M02-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image from verified customer.](http://images.novusbio.com/images2/RAB8A-Antibody-(3G1)-Immunocytochemistry-Immunofluorescence-H00004218-M02-img0005.jpg)
![ELISA: RAB8A Antibody (3G1) [H00004218-M02] - Detection limit for recombinant GST tagged RAB8A is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/images2/RAB8A-Antibody-(3G1)-ELISA-H00004218-M02-img0006.jpg)
