Syntaxin 5 Antibody (5A6)

Images

 
Western Blot: Syntaxin 5 Antibody (5A6) [H00006811-M01] - STX5A expression in A-431 ( Cat # L015V1 ).
Immunocytochemistry/ Immunofluorescence: Syntaxin 5 Antibody (5A6) [H00006811-M01] - Analysis of monoclonal antibody to STX5A on A-431 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Syntaxin 5 Antibody (5A6) [H00006811-M01] - Analysis of monoclonal antibody to STX5A on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml.
ELISA: Syntaxin 5 Antibody (5A6) [H00006811-M01] - Detection limit for recombinant GST tagged STX5 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
5A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Syntaxin 5 Antibody (5A6) Summary

Immunogen
STX5A (NP_003155.1, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSCRDRTQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQ
Specificity
STX5A - syntaxin 5A
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STX5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syntaxin 5 Antibody (5A6)

  • SED5
  • STX5
  • STX5ASED5
  • Syntaxin 5
  • syntaxin 5A
  • syntaxin-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02031
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-47379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-07969
Species: Hu
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87439
Species: Hu
Applications: WB, IHC, IHC-P
H00026984-T01
Species: Hu
NBP2-58069
Species: Hu
Applications: ICC/IF
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91277
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-32493
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006811-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Syntaxin 5 Antibody (H00006811-M01) (0)

There are no publications for Syntaxin 5 Antibody (H00006811-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin 5 Antibody (H00006811-M01) (0)

There are no reviews for Syntaxin 5 Antibody (H00006811-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Syntaxin 5 Antibody (H00006811-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin 5 Products

Bioinformatics Tool for Syntaxin 5 Antibody (H00006811-M01)

Discover related pathways, diseases and genes to Syntaxin 5 Antibody (H00006811-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin 5 Antibody (H00006811-M01)

Discover more about diseases related to Syntaxin 5 Antibody (H00006811-M01).
 

Pathways for Syntaxin 5 Antibody (H00006811-M01)

View related products by pathway.

Blogs on Syntaxin 5

There are no specific blogs for Syntaxin 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin 5 Antibody (5A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol STX5
Entrez
OMIM
Uniprot