SV2B Antibody (2C6)

Product Discontinued

SV2B Antibody (2C6) Summary

• Immunogen: SV2B (NP_055663, 417 a.a. ~ 476 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YFQDEEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDE
• Specificity: SV2B (2C6)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SV2B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SV2B Antibody (2C6)

• FLJ30413
• FLJ42732
• HsT19680
• KIAA0735HsT19680
• SV2B
• synaptic vesicle glycoprotein 2B
• synaptic vesicle protein 2B homolog

Background

Probably plays a role in the control of regulated secretion in neural and endocrine cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SV2B
• Entrez:
  • 9899(Human)
• OMIM:
  • 185861(Human)
• Uniprot:
  • NP_055663()